Property Summary

NCBI Gene PubMed Count 13
PubMed Score 237.59
PubTator Score 270.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.600 1.1e-04
atypical teratoid / rhabdoid tumor 2.900 3.2e-09
cystic fibrosis -1.305 4.8e-06
ependymoma 1.700 9.4e-11
glioblastoma 1.300 1.9e-03
group 3 medulloblastoma 1.200 4.5e-03
lung adenocarcinoma 1.300 1.0e-05
malignant mesothelioma 5.300 1.9e-09
medulloblastoma, large-cell -1.700 4.6e-06
non primary Sjogren syndrome sicca 1.500 1.3e-02
osteosarcoma -2.812 5.9e-12
ovarian cancer 1.300 3.9e-04
primitive neuroectodermal tumor 2.200 9.1e-04
spina bifida 1.261 4.1e-02

Gene RIF (3)

AA Sequence

MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKVHPTSTRFTFRTARQVPRLGVMLVGWGGNN      1 - 70
GSTLTAAVLANRLRLSWPTRSGRKEANYYGSLTQAGTVSLGLDAEGQEVFVPFSAVLPMVAPNDLVFDGW     71 - 140
DISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD    141 - 210
IRDFRSSAGLDKVIVLWTANTERFCEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSP    211 - 280
QNTLVPGALELAWQHRVFVGGDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFR    281 - 350
SKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS    351 - 420
LLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSPVVNALFRQRSCIENIL    421 - 490
RACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPVPAATNGCTGDANGHLQEEPPMPTT      491 - 558
//

Text Mined References (20)

PMID Year Title