Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.72
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer 1.200 7.0e-03
cutaneous lupus erythematosus -1.600 4.1e-02
cystic fibrosis 1.046 5.6e-05
ependymoma 1.100 9.1e-10
glioblastoma 1.100 7.6e-05
interstitial cystitis -1.100 5.9e-03
intraductal papillary-mucinous adenoma (... 1.200 4.7e-05
intraductal papillary-mucinous neoplasm ... 1.500 5.6e-03
lung cancer 1.600 2.3e-02
malignant mesothelioma -3.900 1.5e-08
ovarian cancer 1.300 4.5e-03
pediatric high grade glioma 1.100 2.3e-03
subependymal giant cell astrocytoma 1.156 1.9e-02

Gene RIF (4)

AA Sequence

MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPL      1 - 70
EEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLR     71 - 140
KNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWS    141 - 210
LRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQR    211 - 280
AVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAVDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDH    281 - 350
KWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQ    351 - 420
VMEVGNEE                                                                  421 - 428
//

Text Mined References (15)

PMID Year Title