Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $62,708.93
PubMed Score 10.59
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9NPH0 Q59G61 Q5T490 Q6IAQ3 Q7LG81 Q9UIG6
Symbols LPAP
ACPL1
PACPL1

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

4JOB   4JOC   4JOD  

Gene RIF (4)

PMID Text
23807634 structures and biochemical studies of human lysophosphatidic acid phosphatase type 6
20877624 Observational study of gene-disease association. (HuGE Navigator)
15280042 Human seminal plasma contains this enzyme which converts lysophospholipids to lysophosphatidic acid.
12010880 acid phosphatase-like protein 1 from human intestinal tissue could be associated with interstitial cells of Cajal function ACPL1

AA Sequence

MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPL      1 - 70
EEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFAGQLTKVGMQQMFALGERLR     71 - 140
KNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCWS    141 - 210
LRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQR    211 - 280
AVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAVDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDH    281 - 350
KWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQ    351 - 420
VMEVGNEE                                                                  421 - 428
//

Text Mined References (15)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23807634 2013 Crystal structures and biochemical studies of human lysophosphatidic acid phosphatase type 6.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15280042 2004 Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...