Property Summary

NCBI Gene PubMed Count 13
PubMed Score 55.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 7.9e-07
ovarian cancer 8520 2.3e-05
psoriasis 6694 7.6e-04
Multiple myeloma 1332 3.3e-03
glioblastoma 5792 9.9e-03

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 9.9e-03
malignant mesothelioma 1.400 7.9e-07
Multiple myeloma 1.301 3.3e-03
ovarian cancer -1.300 2.3e-05
psoriasis -1.300 7.6e-04

AA Sequence

MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIV      1 - 70
LHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEF     71 - 140
DEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI    141 - 210
VSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYL    211 - 280
AATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE          281 - 344
//

Text Mined References (15)

PMID Year Title