Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.19
PubTator Score 3.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
lung adenocarcinoma 2716 5.8e-18
non-small cell lung cancer 2890 5.2e-12
nephrosclerosis 333 3.7e-04
osteosarcoma 7950 2.6e-03
Breast cancer 3578 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Aicardi-Goutieres syndrome 19 3.206 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.200 4.3e-02
lung adenocarcinoma -1.100 5.8e-18
nephrosclerosis 1.146 3.7e-04
non-small cell lung cancer -1.120 5.2e-12
osteosarcoma -1.479 2.6e-03

 IMPC Phenotype (1)

Gene RIF (4)

AA Sequence

MMQLLQLLLGLLGPGGYLFLLGDCQEVTTLTVKYQVSEEVPSGTVIGKLSQELGREERRRQAGAAFQVLQ      1 - 70
LPQALPIQVDSEEGLLSTGRRLDREQLCRQWDPCLVSFDVLATGDLALIHVEIQVLDINDHQPRFPKGEQ     71 - 140
ELEISESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHFALDVIVGPDETKHAELIVVKELDREIHSFF    141 - 210
DLVLTAYDNGNPPKSGTSLVKVNVLDSNDNSPAFAESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVE    211 - 280
FFLSKHMPPEVLDTFSIDAKTGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIP    281 - 350
SIHVTWASQPSLVSEALPKDSFIALVMADDLDSGHNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDR    351 - 420
EQWPKYTLTLLAQDQGLQPLSAKKQLSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLITIKAHDADLG    421 - 490
INGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVSLLDAND    491 - 560
NAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETPNGLGPAGTDTPPLATHSSRPFLLTTIVARDADSGA    561 - 630
NGEPLYSIRSGNEAHLFILNPHTGQLFVNVTNASSLIGSEWELEIVVEDQGSPPLQTRALLRVMFVTSVD    631 - 700
HLRDSARKPGALSMSMLTVICLAVLLGIFGLILALFMSICRTEKKDNRAYNCREAESTYRQQPKRPQKHI    701 - 770
QKADIHLVPVLRGQAGEPCEVGQSHKDVDKEAMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAPAESRE    771 - 840
VLQDTVNLLFNHPRQRNASRENLNLPEPQPATGQPRSRPLKVAGSPTGRLAGDQGSEEAPQRPPASSATL    841 - 910
RRQRHLNGKVSPEKESGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQQISQLLSLLHQGQFQPKPNH    911 - 980
RGNKYLAKPGGSRSAIPDTDGPSARAGGQTDPEQEEGPLDPEEDLSVKQLLEEELSSLLDPSTGLALDRL    981 - 1050
SAPDPAWMARLSLPLTTNYRDNVISPDAAATEEPRTFQTFGKAEAPELSPTGTRLASTFVSEMSSLLEML   1051 - 1120
LEQRSSMPVEAASEALRRLSVCGRTLSLDLATSAASGMKVQGDPGGKTGTEGKSRGSSSSSRCL         1121 - 1184
//

Text Mined References (15)

PMID Year Title