Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.53
PubTator Score 14.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 6.9e-12
Pick disease 1894 5.9e-07
ovarian cancer 8520 1.1e-06
malignant mesothelioma 3232 2.0e-05
psoriasis 6694 1.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Non-immune hydrops fetalis 11

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 2.0e-05
osteosarcoma -3.162 6.9e-12
ovarian cancer 1.400 1.1e-06
Pick disease 1.100 5.9e-07
psoriasis -2.200 1.4e-04

Gene RIF (7)

AA Sequence

MSEPHRVQFTSLPGSLNPAFLKKSRKEEAGAGEQHQDCEPAAAAVRITLTLFEPDHKRCPEFFYPELVKN      1 - 70
IRGKVKGLQPGDKKKDLSDPFNDEEKERHKVEALARKFEEKYGGKKRRKDRIQDLIDMGYGYDESDSFID     71 - 140
NSEAYDELVPASLTTKYGGFYINSGTLQFRQASESEDDFIKEKKKKSPKKRKLKEGGEKIKKKKKDDTYD    141 - 210
KEKKSKKSKFSKAGFTALNASKEKKKKKYSGALSVKEMLKKFQKEKEAQKKREEEHKPVAVPSAEAQGLR    211 - 280
ELEGASDPLLSLFGSTSDNDLLQAATAMDSLTDLDLEHLLSESPEGSPFRDMDDGSDSLGVGLDQEFRQP    281 - 350
SSLPEGLPAPLEKRVKELAQAARAAEGESRQKFFTQDINGILLDIEAQTRELSSQVRSGVYAYLASFLPC    351 - 420
SKDALLKRARKLHLYEQGGRLKEPLQKLKEAIGRAMPEQMAKYQDECQAHTQAKVAKMLEEEKDKEQRDR    421 - 490
ICSDEEEDEEKGGRRIMGPRKKFQWNDEIRELLCQVVKIKLESQDLERNNKAQAWEDCVKGFLDAEVKPL    491 - 560
WPKGWMQARTLFKESRRGHGHLTSILAKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTG    561 - 630
GLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEAVSKELAALNSRAAGNSEFTLPAPSK    631 - 700
APAEKVGGVLCTEEKRNFAKPSPSAPPPASSLQSPLNFLAEQALALGQSSQEKKPESSGYKELSCQAPLN    701 - 770
KGLPEVHQSKAKHHSLPRTSHGPQVAVPVPGPQVKVFHAGTQQQKNFTPPSPFANKLQGPKASPTQCHRS    771 - 840
LLQLVKTAAKGQGFHPSAPATSGGLSASSSSSHKTPASSSSALSHPAKPHSVSSAGSSYKNNPFASSISK    841 - 910
HGVSSGSSSSGGTPVQSSVSGSLVPGIQPPSVGQATSRPVPSSAGKKMPVSQKLTLVAPPGGPNGDSSGG    911 - 980
TQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLMASPYKSSSPKLSGAMSSNSLGIITPVP    981 - 1050
IPVHVLSFSADSSAKAGVSKDAIVTGPAPGSFHHGLGHSLLAGLHSSPPHAAPLPHAAVPTHIPQSLPGA   1051 - 1120
SQLHGKGPAVPRKL                                                           1121 - 1134
//

Text Mined References (24)

PMID Year Title