Property Summary

NCBI Gene PubMed Count 84
PubMed Score 397.85
PubTator Score 252.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 5.5e-04
astrocytic glioma -1.200 9.6e-03
Astrocytoma, Pilocytic -1.100 8.6e-04
atypical teratoid / rhabdoid tumor -1.600 5.1e-08
ependymoma -1.400 6.0e-03
glioblastoma -1.400 5.1e-06
group 4 medulloblastoma -1.100 2.2e-02
medulloblastoma, large-cell -1.600 1.1e-04
oligodendroglioma -1.100 1.6e-02
pituitary cancer -1.900 3.7e-06
primitive neuroectodermal tumor -1.200 7.2e-04

Gene RIF (74)

AA Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML      1 - 70
VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV     71 - 140
VQAMSRGWDGE                                                               141 - 151
//

Text Mined References (84)

PMID Year Title