Property Summary

NCBI Gene PubMed Count 76
Grant Count 55
R01 Count 35
Funding $14,669,748.43
PubMed Score 364.61
PubTator Score 252.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 0.010
ependymoma -1.800 0.000
oligodendroglioma -1.100 0.016
glioblastoma -1.600 0.000
sonic hedgehog group medulloblastoma -1.400 0.001
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.200 0.001
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.700 0.000
pituitary cancer -1.900 0.000

Gene RIF (66)

PMID Text
26556771 Study characterized the presence of Ngb in the human cochlea
26472601 Data show that the mean peak serum neuroglobin and Nogo-A concentrations were both significantly higher in patients with an unfavorable outcome at 6 months after traumatic brain injury (TBI).
26305249 Findings suggest a control model for neuroglobin's anti-apoptotic activity under physiological conditions. While in normoxic conditions, its activity is maintained at low level, an immediate transition to an hypoxic situation increases it drastically.
25683270 17beta-estradiol-induced NGB up-regulation could act as an oxidative stress sensor, which does not oppose to the pro-apoptotic 17beta-estradiol effect in ER beta-containing colon cancer cells unless a rise of oxidative stress occurs.
25552092 This paper for the first time presents the data on neuroglobin distribution in human cerbellum using immunohistochemistry.
25452214 Data show that chimeric neuroglobin and myoglobin were generated by swapping a regulatory segment.
25372753 The review summarizes the recent experimental findings, mainly focusing on the mechanisms of Ngb's protection and induction during ischemic/hypoxic conditions and it roles in astrocytes, tumors, as well as in neurite outgrowth. [review]
25299774 Neuroglobin player role in estrogen receptor alpha-positive cancer cell viability.
24855999 a mechanism for redox control of human Ngb (hNgb) activity
24699645 first X-ray structure of wild-type human neuroglobin is reported at 1.74 A resolution
More...

AA Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVML      1 - 70
VIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAV     71 - 140
VQAMSRGWDGE                                                               141 - 151
//

Text Mined References (76)

PMID Year Title
26556771 2016 Neuroglobin immunoreactivity in the human cochlea.
26472601 2015 Neuroglobin and Nogo-a as biomarkers for the severity and prognosis of traumatic brain injury.
26305249 2015 A Futile Redox Cycle Involving Neuroglobin Observed at Physiological Temperature.
25683270 2015 ER?-dependent neuroglobin up-regulation impairs 17?-estradiol-induced apoptosis in DLD-1 colon cancer cells upon oxidative stress injury.
25552092 2014 [Neuroglobin distribution in the human cerebellar cortex (an immunohistochemical study)].
25452214 2015 Engineered chimeras reveal the structural basis of hexacoordination in globins: a case study of neuroglobin and myoglobin.
25416956 2014 A proteome-scale map of the human interactome network.
25372753 2014 Neuroglobin - recent developments.
25299774 2014 Neuroglobin, a pro-survival player in estrogen receptor ?-positive cancer cells.
24855999 2014 A possible mechanism for redox control of human neuroglobin activity.
More...