Property Summary

NCBI Gene PubMed Count 38
PubMed Score 56.44
PubTator Score 42.23

Knowledge Summary

Patent (5,487)

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.472 9.0e-03
acute myeloid leukemia -1.900 2.0e-02
Astrocytoma, Pilocytic -1.100 2.4e-05
atypical teratoid/rhabdoid tumor 1.400 6.6e-04
Breast cancer -1.200 2.1e-05
chronic lymphosyte leukemia 1.100 6.2e-04
ductal carcinoma in situ 1.400 3.7e-02
ependymoma 1.800 4.1e-02
interstitial cystitis -1.100 2.3e-03
lung cancer 2.100 4.5e-04
lung carcinoma 2.600 1.1e-27
osteosarcoma -1.465 4.2e-03
pituitary cancer 1.200 2.8e-03

Gene RIF (26)

AA Sequence

MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN      1 - 70
LDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRL     71 - 140
VDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS    141 - 210
IICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQG    211 - 280
SHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN    281 - 350
KIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR    351 - 420
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIV    421 - 490
GIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA    491 - 560
SSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN    561 - 630
EQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA                                      631 - 666
//

Text Mined References (40)

PMID Year Title