Property Summary

NCBI Gene PubMed Count 37
PubMed Score 54.65
PubTator Score 42.23

Knowledge Summary

Patent (5,487)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.1472490757196E-27
Breast cancer 3099 3.52051729918374E-10
lung cancer 4473 6.60456667448426E-6
pilocytic astrocytoma 3086 1.26837925398467E-5
osteosarcoma 7933 1.63856249824315E-5
interstitial cystitis 2299 6.9867092702019E-5
chronic lymphosyte leukemia 232 6.18390197494885E-4
atypical teratoid/rhabdoid tumor 1095 6.6423878311378E-4
pituitary cancer 1972 0.00275930847275442
active Crohn's disease 918 0.00898903036188619
acute myeloid leukemia 785 0.0203243780362438
ductal carcinoma in situ 1745 0.0367802130823853
ependymoma 2514 0.0408206593556434
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0
Disease Target Count Z-score Confidence
Schizophrenia 503 3.597 1.8
substance-induced psychosis 7 3.409 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 1.800 0.041
osteosarcoma 2.144 0.000
chronic lymphosyte leukemia 1.100 0.001
lung cancer 2.300 0.000
active Crohn's disease 1.472 0.009
interstitial cystitis -1.300 0.000
atypical teratoid/rhabdoid tumor 1.400 0.001
pilocytic astrocytoma -1.100 0.000
lung carcinoma 2.600 0.000
Breast cancer -2.100 0.000
ductal carcinoma in situ 1.400 0.037
acute myeloid leukemia -1.900 0.020
pituitary cancer 1.200 0.003

Synonym

Accession Q9NPG1 A8K615 Fz-3
Symbols Fz-3

Gene

  Ortholog (11)

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (25)

PMID Text
25813877 seven-transmembrane domain receptors Celsr3 and Fzd3, in particular, control the development of most longitudinal tracts in the central nervous system. [Review]
25131656 DNA methylation aberrations rather than polymorphisms of FZD3 gene increase the risk of spina bifida in a high-risk region for neural tube defects.
24991956 FZD3 signaling sensitized peripheral sensory neurons in pain hypersensitivity.
24816679 Our analysis showed no significant association between the rs2241802 polymorphism in FZD3 gene and neural tube defects
24815018 Wnt3a/Frizzled-3 signaling plays important role in regulating the proliferation and differentiation of neural crest cells and various developmental stages of melanocyte precursors.
24796881 Aberrant methylation modification of the FZD3 gene increases the risk of congenital hydrocephalus by altering chromatin structure and disturbing gene expression.
24255701 clinical significance of frizzled homolog 3 protein in colorectal cancer patients
22027177 Genetic variants of the FZD3 gene may affect susceptibility to schizophrenia in Chinese Han and Va populations.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN      1 - 70
LDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRL     71 - 140
VDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS    141 - 210
IICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQG    211 - 280
SHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN    281 - 350
KIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR    351 - 420
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIV    421 - 490
GIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA    491 - 560
SSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN    561 - 630
EQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA                                      631 - 666
//

Text Mined References (39)

PMID Year Title
25813877 2015 Celsr3 and Fzd3 in axon guidance.
25131656 2015 DNA methylation aberrations rather than polymorphisms of FZD3 gene increase the risk of spina bifida in a high-risk region for neural tube defects.
24991956 2014 Wnt-Fzd signaling sensitizes peripheral sensory neurons via distinct noncanonical pathways.
24816679 2014 Polymorphisms in FZD3 and FZD6 genes and risk of neural tube defects in a northern Han Chinese population.
24815018 2014 The roles of Frizzled-3 and Wnt3a on melanocyte development: in vitro studies on neural crest cells and melanocyte precursor cell lines.
24796881 2014 Impaired methylation modifications of FZD3 alter chromatin accessibility and are involved in congenital hydrocephalus pathogenesis.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24255701 2013 Clinical significance of frizzled homolog 3 protein in colorectal cancer patients.
22045688 2012 FZD6 is a novel gene for human neural tube defects.
22027177 2011 Association study of the frizzled 3 gene with Chinese Va schizophrenia.
More...