Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.31
PubTator Score 11.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.200 0.000
cutaneous lupus erythematosus 1.100 0.000
astrocytoma 1.500 0.048
glioblastoma 1.600 0.002
adrenocortical carcinoma -1.367 0.000
tuberculosis 1.400 0.000
subependymal giant cell astrocytoma 2.727 0.001
ovarian cancer 1.200 0.006

Synonym

Accession Q9NPF8 Q8N4Q6 Q96SD5
Symbols CENTA2
cent-b
HSA272195

Gene

Gene RIF (7)

PMID Text
26372645 Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis.
23285209 Centaurin-alpha interacts with beta-tubulin and stabilizes microtubules.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19291764 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
14690521 The human gene for centaurin alpha 2 is located on chromosome 17, position 17q11.2, near the neurofibromatosis 1 (NF1) locus and concentrated at the plasma membrane.

AA Sequence

MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWD      1 - 70
DSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREFMADGETISLPGNREGFLW     71 - 140
KRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGLQITYRRDGHTRN    141 - 210
LFVYHESGKEIVDWFNALRAARLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFAL    211 - 280
DCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQ    281 - 350
EWLESLRGVLSSPLTPLNRLTASTESGRSSR                                           351 - 381
//

Text Mined References (17)

PMID Year Title
26372645 2015 ADAP2 Is an Interferon Stimulated Gene That Restricts RNA Virus Entry.
23285209 2012 Centaurin-?? interacts with ?-tubulin and stabilizes microtubules.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20098747 2010 Expanding the substantial interactome of NEMO using protein microarrays.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...