Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.36
PubTator Score 11.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.200 1.2e-03
astrocytoma 1.500 4.8e-02
cutaneous lupus erythematosus 1.100 4.2e-04
glioblastoma 1.600 2.1e-03
ovarian cancer 1.200 5.9e-03
psoriasis 1.900 4.0e-10
subependymal giant cell astrocytoma 2.358 5.6e-03
tuberculosis 1.400 1.7e-04

Gene RIF (8)

AA Sequence

MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWD      1 - 70
DSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREFMADGETISLPGNREGFLW     71 - 140
KRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGLQITYRRDGHTRN    141 - 210
LFVYHESGKEIVDWFNALRAARLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFAL    211 - 280
DCHERRLLYYKNPLDAFEQGQVFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQ    281 - 350
EWLESLRGVLSSPLTPLNRLTASTESGRSSR                                           351 - 381
//

Text Mined References (18)

PMID Year Title