Property Summary

NCBI Gene PubMed Count 218
Grant Count 25
R01 Count 8
Funding $1,667,315.88
PubMed Score 146.13
PubTator Score 904.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.000 0.000
tuberculosis -1.100 0.000
lung cancer 2.000 0.000
diabetes mellitus 1.100 0.002
spina bifida -1.669 0.036

Gene RIF (197)

PMID Text
27053620 The expression of IL-23 significantly increased in chronic atrophic gastritis with intestinal metaplasia tissues and gastric cancer tissues.
26952371 that consumption of star fruit juice at 100g twice daily for one month can significantly depress the pro-inflammation cytokines: TNF-alpha, IL-23, and NO, while increasing walking distance.
26657845 IL-23 mediates the differentiation of Th17 and Treg cells and the production of associated cytokines in DICs. The potential mechanism likely involves the STAT3 pathway.
26656739 we showed that elevated IL-17/IL-23 serum concentrations helped to discriminate BP patients who later relapsed.
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26295034 Our data supports previous reports showing IL-17 and -23 upregulation in association with Multiple sclerosis and potentially identify a previously unknown involvement for CCL27.
26151690 IL-17A, IL-17F and IL23R polymorphisms have no effect on expression of IL-6, IL-17, IL-21 and TGF-beta1 mRNAs expression in H. pylori-infected gastritis.
26062426 IL-23 could promote migration of human ESCC cells by activating DLL4/Notch1 signaling pathway
25887118 potential biomarker for poor therapeutic response in lupus nephritis patients
25877925 mTORC2 regulates lipopolysaccharides-induced expression of IL-12 and IL-23 in human dendritic cells.
More...

AA Sequence

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH      1 - 70
IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH     71 - 140
HWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP                         141 - 189
//

Text Mined References (218)

PMID Year Title
27053620 2016 [Alterations and clinical implications of interleukin 23 and pepsinogen 1 in the sera and tissues of patients with gastric diseases].
26952371 Consumption of star fruit juice on pro-inflammatory markers and walking distance in the community dwelling elderly.
26657845 2016 Interleukin 23 regulates the functions of human decidual immune cells during early pregnancy.
26656739 2015 Integrating longitudinal serum IL-17 and IL-23 follow-up, along with autoantibodies variation, contributes to predict bullous pemphigoid outcome.
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26295034 2015 CCL27: Novel Cytokine with Potential Role in Pathogenesis of Multiple Sclerosis.
26151690 2015 New insight to IL-23/IL-17 axis in Iranian infected adult patients with gastritis: effects of genes polymorphisms on expression of cytokines.
26062426 2015 [IL-23 promotes invasion of esophageal squamous cell carcinoma cells by activating DLL4/Notch1 signaling pathway].
25887118 2015 IL-17 and IL-23 in lupus nephritis - association to histopathology and response to treatment.
25877925 2015 Mammalian target of rapamycin complex 2 (mTORC2) regulates LPS-induced expression of IL-12 and IL-23 in human dendritic cells.
More...