Property Summary

NCBI Gene PubMed Count 30
Grant Count 5
R01 Count 5
Funding $339,524.14
PubMed Score 14.79
PubTator Score 10.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 0.008
ovarian cancer 1.100 0.001

Synonym

Accession Q9NPF5 A8K001 D3DPY8 Q0JSM4 Q5TG41 Q7Z3H7 Q9H0S8 Q9P2C2 DNMAP1
Symbols EAF2
SWC4
MEAF2
DNMAP1
DNMTAP1

Gene

PDB

3HM5   4IEJ  

Gene RIF (6)

PMID Text
24361215 Targeted knockdown of human DNA methyltransferase 1 expression restores the expression levels of tumor suppressor genes, thus inhibiting the proliferation of cholangiocarcinoma cell line cells.
23318425 These results suggest that DMAP1 is a critical regulator of ATM activity and function
21284050 positive staining for DNMT1 in clinical cancer specimens was significantly linked to lower rates of response to treatments and shorter survival of patients with pharyngeal cancer.
20920467 MMTR is an intrinsic negative cell cycle regulator that modulates the CAK kinase activity via interaction with MAT1.
20864525 Knocking down DMAP1 caused hypomethylation of the DNA repair products.
14734556 RGS6 inhibited the transcriptional repressor activity of DMAP1.

AA Sequence

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPP      1 - 70
LLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSE     71 - 140
QEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPG    141 - 210
TDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAE    211 - 280
QRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGV    281 - 350
ELSPTPTEELVHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE    351 - 420
PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP                           421 - 467
//

Text Mined References (38)

PMID Year Title
24361215 2014 si-DNMT1 restore tumor suppressor genes expression through the reversal of DNA hypermethylation in cholangiocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23318425 2014 DMAP1 is an essential regulator of ATM activity and function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21284050 2011 Role of DNA methyltransferase 1 in pharyngeal cancer related to treatment resistance.
20920467 2010 Corepressor MMTR/DMAP1 is an intrinsic negative regulator of CAK kinase to regulate cell cycle progression.
20864525 2010 DNA methyltransferase 1-associated protein (DMAP1) is a co-repressor that stimulates DNA methylation globally and locally at sites of double strand break repair.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...