Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.03
PubTator Score 10.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.6e-04
group 3 medulloblastoma 4104 8.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Fragile X-associated tremor/ataxia syndrome 6 3.246 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 8.1e-03
ovarian cancer 1.100 6.6e-04

Gene RIF (7)

AA Sequence

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPP      1 - 70
LLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSE     71 - 140
QEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPG    141 - 210
TDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAE    211 - 280
QRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGV    281 - 350
ELSPTPTEELVHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE    351 - 420
PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP                           421 - 467
//

Text Mined References (40)

PMID Year Title