Property Summary

NCBI Gene PubMed Count 13
PubMed Score 56.97
PubTator Score 16.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
osteosarcoma 7933 1.66763322046399E-9
Pick disease 1893 2.30852631407414E-5
psoriasis 6685 3.50976457141959E-5
group 3 medulloblastoma 2254 0.00263890702440248
diabetes mellitus 1663 0.00289996602153572

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -2.780 0.000
diabetes mellitus -1.300 0.003
group 3 medulloblastoma 1.200 0.003
Pick disease -1.100 0.000

Synonym

Accession Q9NPF4 Q6IAC3
Symbols KAE1
GCPL1
OSGEP1
PRSMG1

Gene

PANTHER Protein Class (3)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20010699 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQD      1 - 70
IDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIA     71 - 140
YSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSF    141 - 210
IEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQER    211 - 280
GARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD                   281 - 335
//

Text Mined References (16)

PMID Year Title
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20010699 2010 Haplotype-based case-control study on human apurinic/apyrimidinic endonuclease 1/redox effector factor-1 gene and essential hypertension.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039036 2002 Sequencing analysis of a putative human O-sialoglycoprotein endopeptidase gene (OSGEP) and analysis of a bidirectional promoter between the OSGEP and APEX genes.
More...