Property Summary

NCBI Gene PubMed Count 16
PubMed Score 59.21
PubTator Score 16.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 2.9e-03
group 3 medulloblastoma 1.200 2.6e-03
osteosarcoma -2.780 1.7e-09
Pick disease -1.100 2.3e-05
psoriasis -2.200 3.5e-05

Synonym

Accession Q9NPF4 Q6IAC3
Symbols KAE1
TCS3
GCPL1
GAMOS3
OSGEP1
PRSMG1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQD      1 - 70
IDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIA     71 - 140
YSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSF    141 - 210
IEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQER    211 - 280
GARLFATDERFCIDNGAMIAQAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD                   281 - 335
//

Text Mined References (19)

PMID Year Title