Property Summary

NCBI Gene PubMed Count 32
PubMed Score 27.41
PubTator Score 18.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 6.2e-03
Astrocytoma, Pilocytic 1.900 2.5e-10
atypical teratoid / rhabdoid tumor -1.100 2.1e-03
Breast cancer 2.400 2.9e-02
cystic fibrosis 2.351 1.4e-06
glioblastoma 1.500 1.6e-06
group 4 medulloblastoma -1.500 1.1e-05
interstitial cystitis 1.500 7.6e-04
intraductal papillary-mucinous carcinoma... -1.600 4.3e-02
invasive ductal carcinoma 1.400 1.2e-03
lung carcinoma -1.200 7.1e-12
medulloblastoma, large-cell -1.300 1.0e-02
osteosarcoma -2.510 1.2e-05
ovarian cancer 1.800 1.3e-03
pancreatic cancer 1.600 1.5e-02
pediatric high grade glioma 1.800 6.1e-10
pituitary cancer 1.600 5.1e-06
primary pancreatic ductal adenocarcinoma 1.700 5.9e-03
primary Sjogren syndrome 1.200 3.5e-04
subependymal giant cell astrocytoma 1.221 3.9e-02
tuberculosis and treatment for 6 months -1.600 3.4e-04
ulcerative colitis 1.100 9.6e-03

Gene RIF (15)

AA Sequence

MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLE      1 - 70
LSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTG     71 - 140
RGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHK    141 - 210
RYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYE    211 - 280
TLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLK    281 - 350
LE                                                                        351 - 352
//

Text Mined References (33)

PMID Year Title