Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.37
PubTator Score 24.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (15)

AA Sequence

MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPL      1 - 70
TWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCT     71 - 140
LSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPS    141 - 210
VGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTS    211 - 280
LP                                                                        281 - 282
//

Text Mined References (30)

PMID Year Title