Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.43
PubTator Score 18.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 7.5e-04
Breast cancer 1.100 1.8e-05
cystic fibrosis 1.057 1.7e-04
glioblastoma 1.200 1.7e-03
interstitial cystitis 1.500 2.4e-02
intraductal papillary-mucinous adenoma (... -2.200 4.6e-03
intraductal papillary-mucinous carcinoma... -2.800 2.1e-03
non-small cell lung cancer 1.188 3.1e-07
osteosarcoma -1.641 5.2e-04
pancreatic cancer -1.900 1.2e-03
periodontitis 2.200 1.0e-28
posterior fossa group A ependymoma 1.600 3.4e-07
primary pancreatic ductal adenocarcinoma -2.088 1.1e-03
tuberculosis -2.400 2.1e-08
ulcerative colitis 1.800 2.5e-03

Gene RIF (2)

AA Sequence

MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEPALSAGVPGGT      1 - 70
TWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTLDLRQEMPPPRVFKSFLSLLF     71 - 140
QGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSAFWLGLLYLVSPLENEPKEMLTLSEYHERVR    141 - 210
SQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADR    211 - 280
NTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGAN    281 - 350
SAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA    351 - 420
HGVRTSEGAEGSAQGPH                                                         421 - 437
//

Text Mined References (9)

PMID Year Title