Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $254,615
PubMed Score 17.26
PubTator Score 18.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NPE6 O43648
Symbols SUN4
CT127

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
23818324 SPAG4 knockdown reduces the invasion capability of RCC cells.
23602831 SPAG4 is an independent prognostic factor in renal cell carcinoma and plays a crucial role in cytokinesis to defend against hypoxia-induced tetraploid formation.

AA Sequence

MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEPALSAGVPGGT      1 - 70
TWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTLDLRQEMPPPRVFKSFLSLLF     71 - 140
QGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSAFWLGLLYLVSPLENEPKEMLTLSEYHERVR    141 - 210
SQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADR    211 - 280
NTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGAN    281 - 350
SAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA    351 - 420
HGVRTSEGAEGSAQGPH                                                         421 - 437
//

Text Mined References (9)

PMID Year Title
25775403 2015 SEPT12/SPAG4/LAMINB1 complexes are required for maintaining the integrity of the nuclear envelope in postmeiotic male germ cells.
23818324 2014 Hypoxia regulates the sperm associated antigen 4 (SPAG4) via HIF, which is expressed in renal clear cell carcinoma and promotes migration and invasion in vitro.
23602831 2013 Sperm-associated antigen 4, a novel hypoxia-inducible factor 1 target, regulates cytokinesis, and its expression correlates with the prognosis of renal cell carcinoma.
14614621 2004 Human sperm associated antigen 4 (SPAG4) is a potential cancer marker.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10373309 1999 Spag4, a novel sperm protein, binds outer dense-fiber protein Odf1 and localizes to microtubules of manchette and axoneme.
9691178 1998 A novel testis-specific gene, SPAG4, whose product interacts specifically with outer dense fiber protein ODF27, maps to human chromosome 20q11.2.