Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
Funding $599,752.29
PubMed Score 16.67
PubTator Score 16.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.040
ovarian cancer 2.200 0.000

Gene RIF (5)

PMID Text
25906515 Indian aplastic anemia patients did not have NOP10 mutations.
23166591 Expression of HIV-1 Tat upregulates the abundance of NOP10 ribonucleoprotein (NOP10) in the nucleoli of Jurkat T-cells
20008900 Effects of dyskeratosis congenita mutations in NOP10 on assembly of H/ACA pre-RNPs
17507419 NOP10 has a role in the telomerase complex and telomere maintenance, and in autosomal recessive dyskeratosis congenita
15814878 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL            1 - 64
//

Text Mined References (20)

PMID Year Title
25906515 2014 Detection of mutations in TERT, the genes for telomerase reverse transcriptase, in Indian patients of aplastic anaemia: a pilot study.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
23685356 2013 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22527283 2012 An enhanced H/ACA RNP assembly mechanism for human telomerase RNA.
21269460 2011 Initial characterization of the human central proteome.
20351177 2010 Specificity and stoichiometry of subunit interactions in the human telomerase holoenzyme assembled in vivo.
20008900 2010 Effects of dyskeratosis congenita mutations in dyskerin, NHP2 and NOP10 on assembly of H/ACA pre-RNPs.
19179534 2009 A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis.
More...