Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.84
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.99815643736491E-8
medulloblastoma, large-cell 6234 0.00336529996225451
atypical teratoid / rhabdoid tumor 4369 0.00413854686913369
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0141528537941925

Expression

  Differential Expression (4)

Synonym

Accession Q9NPE2 B2R6M8 Q4V9L7 Q9HBL4
Symbols DSC92

Gene

  Ortholog (7)

 MGI Term (1)

Pathway (1)

AA Sequence

MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIR      1 - 70
RQMEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKV     71 - 140
LKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGR    141 - 210
NKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREF    211 - 280
FDSNGNFLYRI                                                               281 - 291
//

Text Mined References (11)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118320 2000 Two novel genes, human neugrin and mouse m-neugrin, are upregulated with neuronal differentiation in neuroblastoma cells.
More...