Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.01
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.1e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-02
medulloblastoma, large-cell -1.100 3.4e-03
osteosarcoma 1.839 2.0e-08

AA Sequence

MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELQEVESTLKRQKQAIRFQKIR      1 - 70
RQMEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKV     71 - 140
LKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGR    141 - 210
NKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREF    211 - 280
FDSNGNFLYRI                                                               281 - 291
//

Text Mined References (11)

PMID Year Title