Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.74
PubTator Score 11.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.700 0.001
ependymoma -1.200 0.010
oligodendroglioma -1.200 0.017
group 3 medulloblastoma 2.100 0.001
medulloblastoma, large-cell 1.600 0.003
primitive neuroectodermal tumor 1.100 0.035
Atopic dermatitis 1.100 0.002
adrenocortical carcinoma 2.760 0.000
non-small cell lung cancer 3.275 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.002
intraductal papillary-mucinous neoplasm ... 1.500 0.002
pancreatic cancer 1.500 0.000
breast carcinoma 2.300 0.000
lung adenocarcinoma 2.200 0.000
pilocytic astrocytoma -1.400 0.000
psoriasis 1.500 0.000
nasopharyngeal carcinoma 1.400 0.002
Endometriosis 1.290 0.027
Breast cancer 3.000 0.000
lung carcinoma 1.200 0.000
Alzheimer's disease -1.100 0.037
Pick disease -1.200 0.001
ductal carcinoma in situ 2.500 0.002
invasive ductal carcinoma 3.600 0.000
ovarian cancer 1.400 0.000
pituitary cancer 1.700 0.000

Synonym

Accession Q9NPD8 Q2TU36
Symbols FANCT
PIG50
HSPC150

Gene

PDB

4CCG   1YH2  

Gene RIF (10)

PMID Text
26308072 Identify critical roles of UBE2T in prostate cancer development and progression.
26119737 UBE2T is the primary E2 of the FA pathway required for FANCD2 and FANCI activation.
26085575 we identified UBE2T as a bona fide FA gene (FANCT) that also may be a rare cancer susceptibility gene.
26046368 Mutations in the gene encoding the E2 conjugating enzyme UBE2T cause Fanconi anemia
21722982 hypoxic conditions down-regulate UBE2T expression which correlates with an increased sensitivity to crosslinking agents consistent with a defective Fanconi anemia pathway
19887602 Our data imply a critical role of UBE2T in development and/or progression of breast cancer through the interaction with and the regulation of the BRCA1/BARD1 complex.
19589784 Upon the occurrence of DNA damage, FANCI becomes monoubiquitinated on Lys-523 by the UBE2T-FANCL pair.
19111657 This work therefore establishes a system that provides mechanistic insight into the functions of FANCL and FANCI in the catalysis of FANCD2 monoubiquitination.
18667844 UBE2T was significantly upregulated in lung cancer tissue and cell lines, suggesting involvement of UBE2T in the malignant cell phenotype.
16916645 UBE2T is the ubiquitin-conjugating enzyme (E2) in the Fanconi anemia pathway and has a self-inactivation mechanism that could be important for negative regulation of the Fanconi anemia pathway.

AA Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF      1 - 70
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL     71 - 140
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV                 141 - 197
//

Text Mined References (25)

PMID Year Title
26308072 2015 Elevated expression of UBE2T exhibits oncogenic properties in human prostate cancer.
26119737 2015 Deficiency of UBE2T, the E2 Ubiquitin Ligase Necessary for FANCD2 and FANCI Ubiquitination, Causes FA-T Subtype of Fanconi Anemia.
26085575 2015 AluY-mediated germline deletion, duplication and somatic stem cell reversion in UBE2T defines a new subtype of Fanconi anemia.
26046368 2015 Mutations in the gene encoding the E2 conjugating enzyme UBE2T cause Fanconi anemia.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21775430 2011 Structural analysis of human FANCL, the E3 ligase in the Fanconi anemia pathway.
21722982 2011 Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.
21269460 2011 Initial characterization of the human central proteome.
More...