Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.80
PubTator Score 11.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
FANCONI ANEMIA, COMPLEMENTATION GROUP T 1 0.0 0.0
Kidney Neoplasms 37 0.0 0.0
Disease Target Count
Fanconi anemia 56

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 2.760 7.1e-06
Alzheimer's disease -1.100 3.7e-02
astrocytic glioma -1.700 1.2e-03
Astrocytoma, Pilocytic -1.400 1.9e-06
Atopic dermatitis 1.100 2.4e-03
Breast cancer 2.800 1.5e-23
breast carcinoma 2.100 3.0e-06
ductal carcinoma in situ 2.500 2.3e-03
Endometriosis 1.290 2.7e-02
ependymoma -1.200 9.9e-03
group 3 medulloblastoma 2.100 1.0e-03
intraductal papillary-mucinous carcinoma... 1.200 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.7e-03
invasive ductal carcinoma 3.600 7.2e-05
lung adenocarcinoma 1.400 4.1e-11
lung carcinoma 1.200 2.0e-14
medulloblastoma, large-cell 1.600 2.8e-03
nasopharyngeal carcinoma 1.400 1.6e-03
non-small cell lung cancer 3.275 2.5e-35
oligodendroglioma -1.200 1.7e-02
ovarian cancer 1.400 3.3e-04
pancreatic cancer 1.500 6.2e-06
Pick disease -1.200 1.4e-03
pituitary cancer 1.700 1.3e-06
primitive neuroectodermal tumor 1.100 3.5e-02
psoriasis 1.400 5.0e-39

Protein-protein Interaction (2)

Gene RIF (15)

AA Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF      1 - 70
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL     71 - 140
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV                 141 - 197
//

Text Mined References (33)

PMID Year Title