Property Summary

NCBI Gene PubMed Count 15
Grant Count 45
R01 Count 18
Funding $9,426,152.59
PubMed Score 93.21
PubTator Score 18.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
nephrosclerosis 1.051 0.038
malignant mesothelioma 6.400 0.000
astrocytoma -4.000 0.003
posterior fossa group A ependymoma -4.700 0.000
oligodendroglioma -1.900 0.000
psoriasis -1.900 0.000
glioblastoma -3.000 0.000
cystic fibrosis 3.067 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
primitive neuroectodermal tumor -2.500 0.007
Duchenne muscular dystrophy 1.051 0.000
autosomal dominant Emery-Dreifuss muscul... 1.039 0.008
adrenocortical carcinoma 1.871 0.043
intraductal papillary-mucinous neoplasm ... -1.300 0.002
lung cancer -3.400 0.000
Parkinson's disease -1.300 0.014
breast carcinoma -1.600 0.000
fibroadenoma -1.800 0.008
interstitial cystitis 1.300 0.002
lung adenocarcinoma -2.100 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -4.300 0.000
lung carcinoma -1.100 0.000
non-small cell lung carcinoma -1.800 0.000
Pick disease -1.300 0.028
ductal carcinoma in situ -2.100 0.001
invasive ductal carcinoma -3.500 0.000
Breast cancer 1.300 0.002
pituitary cancer -2.600 0.000
Down syndrome -1.300 0.001

Gene RIF (9)

PMID Text
26700405 (i) NRN1 variability is a shared risk factor for both schizophrenia-spectrum disorders (SSD) and bipolar disorders (BPD), (ii) NRN1 may have a selective impact on age at onset and intelligence in SSD.
26208391 Data indicate that neuritin not only plays an important role in the nervous system but also has an effect on the migration, senescence, proliferation, and viability of stem cells
25101829 Neuritin is reduced in the brains of Alzheimer's disease (AD) patients.
25036738 MiR-204 promotes apoptosis in oxidative stress-induced rat Schwann cells by suppressing neuritin expression
21652774 Data show that SMN and HuD form a complex in spinal motor axons, and that both interact with cpg15 mRNA in neurons.
20405246 we found neuritin is overexpressed in astrocytoma, which may be an important factor in tumorigenesis and progression of astrocytoma
19569075 NRN1 polymorphisms have roles in fluid intelligence in schizophrenia
18265009 CPG15 and CPG15-2 perform similar cellular functions but may play distinct roles in vivo through their cell-type- and tissue-specific transcriptional regulation
16723126 By Northern blot, we confirm hypoxia-induced expression of insulin-like growth factor binding protein 3 (igfbp3), thioredoxin-interacting protein (txnip), neuritin (nrn1).

AA Sequence

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWE      1 - 70
DFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPAFPVLLVSLSAALATWL     71 - 140
SF                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title
26700405 2016 Involvement of NRN1 gene in schizophrenia-spectrum and bipolar disorders and its impact on age at onset and cognitive functioning.
26208391 2015 Effects of neuritin on the migration, senescence and proliferation of human bone marrow mesenchymal stem cells.
25101829 2014 Neuritin attenuates cognitive function impairments in tg2576 mouse model of Alzheimer's disease.
25036738 2014 MiR-204 promotes apoptosis in oxidative stress-induced rat Schwann cells by suppressing neuritin expression.
21652774 2011 Interaction of survival of motor neuron (SMN) and HuD proteins with mRNA cpg15 rescues motor neuron axonal deficits.
20405246 2011 Neuritin expression and its relation with proliferation, apoptosis, and angiogenesis in human astrocytoma.
19569075 2010 Impact of Neuritin 1 (NRN1) polymorphisms on fluid intelligence in schizophrenia.
18265009 2008 cpg15 and cpg15-2 constitute a family of activity-regulated ligands expressed differentially in the nervous system to promote neurite growth and neuronal survival.
16723126 2006 Characterization of the expression of the hypoxia-induced genes neuritin, TXNIP and IGFBP3 in cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...