Property Summary

NCBI Gene PubMed Count 19
PubMed Score 106.73
PubTator Score 18.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 1.871 4.3e-02
adult high grade glioma -1.300 4.1e-02
astrocytic glioma -2.800 4.2e-03
Astrocytoma, Pilocytic -4.300 4.3e-09
atypical teratoid / rhabdoid tumor -4.600 4.5e-09
autosomal dominant Emery-Dreifuss muscul... 1.039 8.3e-03
Breast cancer 1.300 2.0e-03
breast carcinoma -1.600 1.8e-04
cystic fibrosis 3.067 7.0e-07
Down syndrome -1.300 1.5e-03
Duchenne muscular dystrophy 1.051 4.8e-06
ductal carcinoma in situ -2.100 1.2e-03
ependymoma -4.100 7.0e-03
fibroadenoma -1.800 8.2e-03
glioblastoma -1.600 1.7e-03
interstitial cystitis 1.300 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.1e-03
invasive ductal carcinoma -3.500 6.2e-05
lung adenocarcinoma -1.900 5.1e-16
lung cancer -1.900 1.2e-02
lung carcinoma -1.100 3.7e-05
malignant mesothelioma 6.400 9.2e-10
nephrosclerosis 1.051 3.8e-02
non-small cell lung carcinoma -1.800 8.3e-25
oligodendroglioma -1.800 3.7e-02
Parkinson's disease -1.300 1.4e-02
Pick disease -1.300 2.8e-02
pituitary cancer -2.600 1.7e-05
primitive neuroectodermal tumor -2.500 7.0e-03
psoriasis -1.800 9.1e-07

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWE      1 - 70
DFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGSLLPAFPVLLVSLSAALATWL     71 - 140
SF                                                                        141 - 142
//

Text Mined References (19)

PMID Year Title