Property Summary

Ligand Count 4
NCBI Gene PubMed Count 124
PubMed Score 137.80
PubTator Score 213.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.561 4.6e-02
active ulcerative colitis 3.667 4.0e-03
colon cancer 3.300 4.7e-02
cystic fibrosis -1.300 6.1e-04
lung cancer 1.800 2.4e-04
non-small cell lung cancer 1.013 3.0e-05
pancreatic cancer 1.500 1.0e-02
pancreatic ductal adenocarcinoma liver m... -2.833 6.6e-04

Gene RIF (113)

AA Sequence

MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLID      1 - 70
GSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETHINPSENSTSSLS     71 - 140
TCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLG    141 - 210
SLNAIGMIGPVIGFALGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLP    211 - 280
KNPNKPQKERKISLSLHVLKTNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVS    281 - 350
SFIGSFTYVFKYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL    351 - 420
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCK    421 - 490
SSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAIQVINSLFSATGGTTFILLTV    491 - 560
KIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCMKWSTNSCGAQGACRIYNSVFFGRVYLGLSI    561 - 630
ALRFPALVLYIVFIFAMKKKFQGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAA    631 - 700
AN                                                                        701 - 702
//

Text Mined References (126)

PMID Year Title