Property Summary

NCBI Gene PubMed Count 115
Grant Count 38
R01 Count 25
Funding $3,262,470.58
PubMed Score 125.21
PubTator Score 213.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.833 0.001
non-small cell lung cancer 1.013 0.000
colon cancer 3.300 0.047
lung cancer 1.800 0.000
active Crohn's disease 1.561 0.046
active ulcerative colitis 3.667 0.004
pancreatic cancer 1.500 0.010
cystic fibrosis -1.300 0.001

 GWAS Trait (1)

Gene RIF (106)

PMID Text
26474710 OATP1B1- and OATP1B3-humanized mice can be used as in vivo tools to assess and possibly predict clinically relevant DDIs.
26409184 Results identified interethnic differences of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes in Korean population compared with other ethnic groups.
26383540 transport of CPR I mediated by OATP1B1 and OATP1B3 and the transport of CPR III mediated by OATPs 1B1, 1B3 and 2B1 is time-dependent, can be saturated and inhibited
26267044 Carriers of a T allele of SLCO1B3-rs4149117 were less sensitive to thrombocytopenia than the homozygotes for the G allele
26264344 Cancer-type Organic Anion Transporting Polypeptide 1B3: Current Knowledge of the Gene Structure, Expression Profile, Functional Implications and Future Perspectives
26191226 Down-regulation of OATP1B1/3 proteins may contribute to pathogenesis of jaundice accompanying advanced cholestatic liver diseases.
26146841 SLCO1B1 and SLCO1B3 polymorphisms contributed to an increased risk of neonatal hyperbilirubinemia.
26134461 Data suggest that OATP1B3 facilitates transport of the shellfish toxin okadaic acid into hepatocytes.
25578040 Data suggest that expression of SLCO1B1 and SLCO1B3 in hepatocytes can be regulated by dietary factors; expression of SLCO1B1 is up-regulated by anthocyanins/anthocyanin glycosides; expression of SLCO1B3 is down-regulated by these fruit pigments.
25456266 HEK293-OATP1B3 cells are resistant to microcystin-LR induced anoikis.
More...

AA Sequence

MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLID      1 - 70
GSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETHINPSENSTSSLS     71 - 140
TCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLG    141 - 210
SLNAIGMIGPVIGFALGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLP    211 - 280
KNPNKPQKERKISLSLHVLKTNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVS    281 - 350
SFIGSFTYVFKYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL    351 - 420
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCK    421 - 490
SSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAIQVINSLFSATGGTTFILLTV    491 - 560
KIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCMKWSTNSCGAQGACRIYNSVFFGRVYLGLSI    561 - 630
ALRFPALVLYIVFIFAMKKKFQGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAA    631 - 700
AN                                                                        701 - 702
//

Text Mined References (117)

PMID Year Title
26474710 2015 Preclinical Mouse Models To Study Human OATP1B1- and OATP1B3-Mediated Drug-Drug Interactions in Vivo.
26409184 2015 Comparison of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes among five ethnic groups.
26383540 2016 Organic anion transporting polypeptide (OATP)-mediated transport of coproporphyrins I and III.
26267044 2015 Polymorphisms in SLCO1B3 and NR1I2 as genetic determinants of hematotoxicity of carboplatin and paclitaxel combination.
26264344 2015 Cancer-type Organic Anion Transporting Polypeptide 1B3: Current Knowledge of the Gene Structure, Expression Profile, Functional Implications and Future Perspectives.
26191226 2015 Down-regulation of OATP1B proteins correlates with hyperbilirubinemia in advanced cholestasis.
26146841 2015 Multiple Genetic Modifiers of Bilirubin Metabolism Involvement in Significant Neonatal Hyperbilirubinemia in Patients of Chinese Descent.
26134461 2015 Okadaic acid is taken-up into the cells mediated by human hepatocytes transporter OATP1B3.
25578040 2015 Effects of anthocyans on the expression of organic anion transporting polypeptides (SLCOs/OATPs) in primary human hepatocytes.
25456266 2014 Microcystin-LR induces anoikis resistance to the hepatocyte uptake transporter OATP1B3-expressing cell lines.
More...