Property Summary

NCBI Gene PubMed Count 24
PubMed Score 63.39
PubTator Score 113.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Frontonasal dysplasia 6
Disease Target Count P-value
non-small cell lung cancer 2890 3.4e-08
lung cancer 4740 1.4e-06
Breast cancer 3577 3.8e-06
interstitial cystitis 2312 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Nephroblastoma 51 4.299 2.1
Duodenogastric reflux 8 3.685 1.8
Kidney disease 430 3.233 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.700 3.8e-06
interstitial cystitis -1.600 1.6e-03
lung cancer 3.600 1.4e-06
non-small cell lung cancer 1.408 3.4e-08

 GO Component (1)

Gene RIF (12)

AA Sequence

MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKIL      1 - 70
ESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLR     71 - 140
EWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNPLNGSGKSVLG    141 - 210
SSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILN    211 - 280
PMSANLVDLGS                                                               281 - 291
//

Text Mined References (25)

PMID Year Title