Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.97
PubTator Score 4.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 3.9e-07
osteosarcoma 7950 2.0e-04
psoriasis 6694 5.2e-04
ovarian cancer 8520 7.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.2
Multiple Sclerosis 540 0.0 1.9
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 3.638 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 3.9e-07
osteosarcoma -1.413 2.0e-04
ovarian cancer 1.200 7.5e-04
psoriasis -1.200 5.2e-04

Gene RIF (4)

AA Sequence

MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENNVFLDQSQVKA      1 - 70
DGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAFIANPSSTEISSITGNIELNQ     71 - 140
QTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASVE    141 - 210
LFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASV    211 - 280
KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVR    281 - 350
THTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC    351 - 420
GQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHF    421 - 490
RSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDM    491 - 560
TLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY                        561 - 610
//

Text Mined References (24)

PMID Year Title