Property Summary

NCBI Gene PubMed Count 31
PubMed Score 377.06
PubTator Score 439.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Burkitt Lymphoma 20 0.0 0.0
Disease Target Count
Blood group antigen abnormality 2
Disease Target Count P-value
malignant mesothelioma 3232 1.2e-04
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 4.658 2.3
Fabry disease 11 4.057 2.0
Disease Target Count
Caffey disease 6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.300 1.2e-04

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPTPP      1 - 70
SHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQ     71 - 140
MLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGT    141 - 210
QSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLP    211 - 280
PEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMK    281 - 350
MYL                                                                       351 - 353
//

Text Mined References (34)

PMID Year Title