Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.18
PubTator Score 7.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.300 2.0e-13
invasive ductal carcinoma -1.382 6.6e-04
medulloblastoma 1.100 5.2e-03
Multiple myeloma 1.753 2.3e-03
ovarian cancer 1.100 1.6e-02

Gene RIF (2)

AA Sequence

MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSE      1 - 70
EYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMK     71 - 140
GEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPL    141 - 210
GNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI       211 - 277
//

Text Mined References (20)

PMID Year Title