Tbio | E3 ubiquitin-protein ligase CCNB1IP1 |
E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]
HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]
Comments
Disease | Target Count | P-value |
---|---|---|
Breast cancer | 3099 | 2.01501414678851E-13 |
sonic hedgehog group medulloblastoma | 1482 | 9.88243177387446E-8 |
invasive ductal carcinoma | 2950 | 6.5785159270212E-4 |
Multiple myeloma | 1328 | 0.00231345386005773 |
ovarian cancer | 8492 | 0.016070394667686 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Intravenous leiomyomatosis | 4 | 3.816 | 1.9 |
Smooth muscle tumor | 12 | 3.537 | 1.8 |
Uterine fibroid | 29 | 3.43 | 1.7 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.753 | 0.002 |
sonic hedgehog group medulloblastoma | 2.100 | 0.000 |
invasive ductal carcinoma | -1.382 | 0.001 |
Breast cancer | -1.300 | 0.000 |
ovarian cancer | 1.100 | 0.016 |
Accession | Q9NPC3 |
Symbols |
HEI10 C14orf18 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSE 1 - 70 EYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMK 71 - 140 GEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPL 141 - 210 GNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI 211 - 277 //
PMID | Year | Title |
---|---|---|
25416956 | 2014 | A proteome-scale map of the human interactome network. |
21779533 | 2010 | Evidence Implicating CCNB1IP1, a RING Domain-Containing Protein Required for Meiotic Crossing Over in Mice, as an E3 SUMO Ligase. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
17297447 | 2007 | HEI10 negatively regulates cell invasion by inhibiting cyclin B/Cdk1 and other promotility proteins. |
16712791 | 2006 | Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. |
16532029 | 2006 | A functional association between merlin and HEI10, a cell cycle regulator. |
16381901 | 2006 | The LIFEdb database in 2006. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
16341674 | 2005 | Transcriptome analysis of human gastric cancer. |
16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. |
More... |