Property Summary

Ligand Count 46
NCBI Gene PubMed Count 73
PubMed Score 120.78
PubTator Score 151.60

Knowledge Summary

Patent (2,592)

TINX Plot

  Disease (8)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.4e-02
ependymoma -1.500 2.8e-06
glioblastoma -1.100 5.2e-03
group 3 medulloblastoma -2.100 8.7e-03
osteosarcoma 1.041 1.6e-04
ovarian cancer 1.400 1.7e-09
subependymal giant cell astrocytoma -2.025 1.7e-02

Gene RIF (44)

AA Sequence

MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSE      1 - 70
PHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLL     71 - 140
KRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQT    141 - 210
KGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPR    211 - 280
PSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSP    281 - 350
ISSISPGLHSFTDHQRLMKRRKSV                                                  351 - 374
//

Text Mined References (73)

PMID Year Title