Property Summary

NCBI Gene PubMed Count 69
Grant Count 68
R01 Count 51
Funding $5,660,179.4
PubMed Score 113.51
PubTator Score 151.60

Knowledge Summary

Patent (2,592)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.041 0.000
posterior fossa group A ependymoma -1.700 0.000
glioblastoma -1.100 0.005
group 3 medulloblastoma -2.100 0.009
pilocytic astrocytoma -1.100 0.012
subependymal giant cell astrocytoma -2.025 0.017
ovarian cancer 1.400 0.000

Synonym

Accession Q9NPC2 Q2M290 Q540F2
Symbols KT3.2
TASK3
K2p9.1
TASK-3

Gene

PDB

3P1N   3P1O   3P1P   3P1Q   3P1R   3P1S   3SMK   3SML   3SMM   3SMN   3SMO   3SP5   3SPR   3UX0   4FR3  

 GWAS Trait (1)

Gene RIF (41)

PMID Text
25655935 TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes.
25599232 The findings of this study suggest that variations in KCNK9 genes are associated with both mild and severe persistent breast pain after breast cancer surgery.
25482670 During conductance simulation experiments, both TASK-3 and TREK-1 channels were able to repolarise the membrane once AP threshold was reached
25420509 Diacylglycerol mediates regulation of TASK1 and TASK3 potassium channels by GNAQ.
25318378 Interference with TASK-3 channel expression, therefore, induces caspase-dependent and -independent apoptosis of melanoma cells, most likely via causing mitochondrial depolarization.
25078964 Two SNPs replicated: the paternal rs2471083-C allele (located near the imprinted KCNK9 gene) and the paternal rs3091869-T allele (located near the SLC2A10 gene) increased BMI equally (beta = 0.11 (SD), P<0.0027)
24980697 Mutations of KCNK9 or epigenetic disturbances within the PEG13 imprinted cluster do not significantly contribute to the cause of the developmental disabilities tested in this study.
24392765 For KCNK9, two SNPs (i.e., rs3780039, rs11166921) were associated with the occurrence of preoperative breast pain.
24342771 By both a gain-of-function additional mutation of TASK3 channels.
24307172 TNFalpha activation and TASK3 channel activity can promote cellular apoptosis.
More...

AA Sequence

MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSE      1 - 70
PHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLL     71 - 140
KRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQT    141 - 210
KGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPR    211 - 280
PSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSP    281 - 350
ISSISPGLHSFTDHQRLMKRRKSV                                                  351 - 374
//

Text Mined References (70)

PMID Year Title
25655935 2015 TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes.
25599232 2015 Variations in potassium channel genes are associated with distinct trajectories of persistent breast pain after breast cancer surgery.
25482670 2015 Two-pore domain potassium channels enable action potential generation in the absence of voltage-gated potassium channels.
25420509 2014 Diacylglycerol mediates regulation of TASK potassium channels by Gq-coupled receptors.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
25318378 2014 Silencing the KCNK9 potassium channel (TASK-3) gene disturbs mitochondrial function, causes mitochondrial depolarization, and induces apoptosis of human melanoma cells.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25078964 2014 Novel approach identifies SNPs in SLC2A10 and KCNK9 with evidence for parent-of-origin effect on body mass index.
24980697 2014 Screening individuals with intellectual disability, autism and Tourette's syndrome for KCNK9 mutations and aberrant DNA methylation within the 8q24 imprinted cluster.
24392765 Variations in potassium channel genes are associated with breast pain in women prior to breast cancer surgery.
More...