Property Summary

NCBI Gene PubMed Count 46
PubMed Score 71.05
PubTator Score 61.52

Knowledge Summary

Patent (9,228)


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.069357150273E-109
Disease Target Count Z-score Confidence
Asthma 349 3.762 1.9
Trichomoniasis 9 3.221 1.6


Accession Q9NPC1 Q5KU28 Q9NPE5 LTB4-R 2
Symbols BLT2
LTB4-R 2


PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

  TechDev Info (1)

Gene RIF (36)

26966074 BLT2 inhibition induces apoptosis, inhibits proliferation, colony formation and self-renewal capacity of CD34(+) cells from tyrosine kinase inhibitor - resistant blast phase-chronic myeloid leukemia patients.
26597704 Data show that signal transducer and activator of transcription-3 (STAT-3) activation occurs downstream of leukotriene B4 receptor-2 (BLT2) and mediates cisplatin resistance in SK-OV-3 cells.
25691060 Authors demonstrated that MyD88 lies upstream of BLT2 in LPS-potentiated invasiveness and that this 'MyD88-BLT2' cascade mediates activation of NF-kappaB and the synthesis of IL-6 and IL-8 critical for the invasiveness and aggression of breast cancer cells.
25480980 BLT1 and BLT2 are therefore potential targets for the development of novel drugs.
24990945 searched BLT2 downstream components and identified reactive oxygen species and nuclear factor kappaB as critical components that contribute to epithelial-mesenchymal transition in mammary epithelial cells
23986446 BLT2-NOX-ROS-NF-kappaB cascade induction during detachment confers a novel mechanism of anoikis resistance in prostate cancer cells and potentially contributes to prostate cancer progression.
23928309 RanBPM acts as a negative regulator of BLT2 signaling to attenuate BLT2-mediated cell motility
23799854 BLT2 is a novel therapeutic target that sensitises drug-resistant breast cancer cells to paclitaxel.
23603839 Findings indicate that BLT2 has a protective role in allergic airway inflammation and that diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma.
23347335 Findings suggest that, in bronchial epithelial cells, cigarette smoke extracts (CSE) promote induction of pro-inflammatory BLT2 receptors and activate mechanisms leading to increased neutrophil adhesion.

AA Sequence

SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL                                   351 - 389

Text Mined References (47)

PMID Year Title
26966074 2016 Targeting of the BLT2 in chronic myeloid leukemia inhibits leukemia stem/progenitor cell function.
26597704 2016 Leukotriene B4 receptor-2 contributes to chemoresistance of SK-OV-3 ovarian cancer cells through activation of signal transducer and activator of transcription-3-linked cascade.
25691060 2015 Myeloid differentiation primary response gene 88-leukotriene B4 receptor 2 cascade mediates lipopolysaccharide-potentiated invasiveness of breast cancer cells.
25480980 2015 Two distinct leukotriene B4 receptors, BLT1 and BLT2.
24990945 2014 Ras promotes transforming growth factor-? (TGF-?)-induced epithelial-mesenchymal transition via a leukotriene B4 receptor-2-linked cascade in mammary epithelial cells.
23986446 2013 Activation of the leukotriene B4 receptor 2-reactive oxygen species (BLT2-ROS) cascade following detachment confers anoikis resistance in prostate cancer cells.
23928309 2013 RanBPM protein acts as a negative regulator of BLT2 receptor to attenuate BLT2-mediated cell motility.
23799854 2013 A leukotriene B4 receptor-2 is associated with paclitaxel resistance in MCF-7/DOX breast cancer cells.
23603839 2013 Leukotriene B4 receptor BLT2 negatively regulates allergic airway eosinophilia.
23347335 2013 Cigarette smoke increases BLT2 receptor functions in bronchial epithelial cells: in vitro and ex vivo evidence.