Property Summary

NCBI Gene PubMed Count 22
Grant Count 13
R01 Count 13
Funding $997,238.87
PubMed Score 42.68
PubTator Score 20.94

Knowledge Summary

Patent (27,471)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Gene RIF (9)

PMID Text
26699909 Results of this study show that HEK 293 cells express an endogenous CCRL1 gene only at mRNA level. These data therefore represent the important implications for the use of HEK 293 cells as a host cell system for the study of CCX-CKR.
24338720 we found that CCX-CKR expression in vitro could modulate cellular migration and invasion abilities, potentially via the regulation of other chemotactic factors/receptors.
24260134 Effect of genetic variants in two chemokine decoy receptor genes, DARC and CCBP2, on metastatic potential of breast cancer.
23462454 co-expression of DARC, D6, and CCX-CKR significantly associated with higher survival in gastric cancer
23341447 Results suggest that chemokine binding to CCX-CKR recruits Gi proteins and beta-arrestin (beta-arr) with high affinity.
23121557 Data suggest that co-expression of CCX-CKR and CXCR3 (chemokine receptor type 3) in T-lymphocytes results in protein multimerization and prevents CXCR3-mediated chemotaxis; this represents a novel mechanism of regulation of immune cell migration.
19383822 Down regulation of CCX-CKR is associated with breast cancer.
16791897 Scavenges extracellular chemokines in vivo to modify responses through CCR7.
11981810 Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR.

AA Sequence

MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYK      1 - 70
KQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYVA     71 - 140
VTKVPSQSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPRYLGTSMKALIQMLEICIGFV    141 - 210
VPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKR    211 - 280
MDIAIQVTESIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFSI    281 - 350
//

Text Mined References (26)

PMID Year Title
26699909 2016 Endogenous expression of the atypical chemokine receptor CCX-CKR (CCRL1) gene in human embryonic kidney (HEK 293) cells.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24338720 2014 CCX-CKR expression in colorectal cancer and patient survival.
24260134 2013 Effect of genetic variants in two chemokine decoy receptor genes, DARC and CCBP2, on metastatic potential of breast cancer.
23462454 2013 Prognostic impact of atypical chemokine receptor expression in patients with gastric cancer.
23356288 2013 Atypical chemokine receptors: from silence to sound.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
23314186 2013 Genetic variation associated with circulating monocyte count in the eMERGE Network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...