Property Summary

NCBI Gene PubMed Count 51
Grant Count 192
R01 Count 127
Funding $13,653,663.05
PubMed Score 9.52
PubTator Score 26.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9NPB6 O14911 Q9NPJ7 PAR-6
Symbols PAR6
PAR6C
TAX40
PAR-6A
TIP-40
PAR6alpha

Gene

PANTHER Protein Class (2)

PDB

1WMH  

Gene RIF (26)

PMID Text
26050620 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition
25756394 TGFbeta induced Par6 phosphorylation on Ser345 and its recruitment to the leading edge of the membrane ruffle in migrating PC-3U cells, where it colocalised with aPKCzeta. The p-Par6-aPKCzeta complex is important for cell migration and invasion.
23762244 BDNF can regulate formation of functional synapses by increasing the expression of the RhoA inhibitors, Par6C and Rnd3.
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
23341197 Par6 negatively regulates trophoblast fusion via its roles on tight junctions and cytoskeleton dynamics and provide novel insight into the contribution of this polarity marker in altered trophoblast cell fusion typical of preeclampsia.
23249950 Atypical protein kinase C kinase activity, as well as an association with PAR6, were found to be important for PAR6 phosphorylation.
22339630 Pak6 is a binding partner and a outatuve effector protein for the atypical rho GTPase cdc42 homologous protein.
21549621 Data indicate that both tumor focality and Par3/Par6/atypical protein kinase C (APKC) expression were significantly associated with tumor recurrence.
21170030 Data show that DDR1 coordinates the Par3/Par6 cell-polarity complex through its carboxy terminus, binding PDZ domains in Par3 and Par6.
20719959 Par6alpha controls centrosome organization through its association with the dynactin subunit p150(Glued).
More...

AA Sequence

MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLP      1 - 70
LTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFR     71 - 140
QVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLA    141 - 210
VSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDD    211 - 280
DSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL        281 - 346
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26050620 2016 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25756394 2015 TGF?-induced phosphorylation of Par6 promotes migration and invasion in prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23762244 2013 A genome-wide screen of CREB occupancy identifies the RhoA inhibitors Par6C and Rnd3 as regulators of BDNF-induced synaptogenesis.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
23341197 2013 Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia.
More...