Property Summary

NCBI Gene PubMed Count 51
PubMed Score 9.56
PubTator Score 26.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 1.4e-04
astrocytoma -1.100 1.9e-02
Astrocytoma, Pilocytic -1.300 3.3e-07
atypical teratoid / rhabdoid tumor -1.200 2.6e-06
ependymoma -1.100 1.3e-07
glioblastoma -1.200 6.9e-08
medulloblastoma, large-cell -1.300 1.3e-04
subependymal giant cell astrocytoma -1.093 2.4e-02

Protein-protein Interaction (4)

Gene RIF (26)

AA Sequence

MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLP      1 - 70
LTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFR     71 - 140
QVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLA    141 - 210
VSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDD    211 - 280
DSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL        281 - 346
//

Text Mined References (55)

PMID Year Title