Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $138,004.17
PubMed Score 7.50
PubTator Score 5.03

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (1)

PMID Text
22981119 Genetic defects in CABP2 cause moderate-to-severe sensorineural hearing impairment.

AA Sequence

MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQ      1 - 70
LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELM     71 - 140
GPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVD    141 - 210
FEEFVRMMSR                                                                211 - 220
//

Text Mined References (8)

PMID Year Title
22981119 2012 A mutation in CABP2, expressed in cochlear hair cells, causes autosomal-recessive hearing impairment.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11415439 2001 Functional roles and efficiencies of the thioredoxin boxes of calcium-binding proteins 1 and 2 in protein folding.
11108966 2000 Ca(2+)-binding proteins in the retina: from discovery to etiology of human disease(1).
10625670 2000 Five members of a novel Ca(2+)-binding protein (CABP) subfamily with similarity to calmodulin.