Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.72
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQ      1 - 70
LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELM     71 - 140
GPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVD    141 - 210
FEEFVRMMSR                                                                211 - 220
//

Text Mined References (9)

PMID Year Title