Property Summary

Ligand Count 1
NCBI Gene PubMed Count 8
PubMed Score 803.28
PubTator Score 14.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.410 1.5e-04

PDB (18)

Gene RIF (5)

AA Sequence

MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALE      1 - 70
DRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCP     71 - 140
YEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRR    141 - 210
LHSWADDWKAILDSKRPC                                                        211 - 228
//

Text Mined References (8)

PMID Year Title