Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.06
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
group 3 medulloblastoma 1.500 0.000
posterior fossa group A ependymoma 1.100 0.000

Synonym

Accession Q9NPB0 Q9H0D8
Symbols C6orf64

Gene

AA Sequence

MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQE      1 - 70
AAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRG     71 - 140
PEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR                               141 - 183
//

Text Mined References (9)

PMID Year Title
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.