Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.06
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group A ependymoma 468 4.6e-11
malignant mesothelioma 3232 3.9e-06
group 3 medulloblastoma 4104 7.2e-04
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.4

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.2e-04
malignant mesothelioma 1.700 3.9e-06
posterior fossa group A ependymoma 1.100 4.6e-11

AA Sequence

MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQE      1 - 70
AAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRG     71 - 140
PEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR                               141 - 183
//

Text Mined References (9)

PMID Year Title