Property Summary

NCBI Gene PubMed Count 8
PubMed Score 77.08
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.0e-06
ovarian cancer 8520 2.5e-04
lung cancer 4740 5.9e-04
Disease Target Count Z-score Confidence
Warsaw breakage syndrome 11 4.137 2.1
Spinocerebellar ataxia type 7 13 3.151 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.500 1.0e-06
lung cancer 1.300 5.9e-04
ovarian cancer 1.500 2.5e-04

Gene RIF (2)

AA Sequence

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE      1 - 70
ITPKGRALVPDSVKKELLQRIRTFLAQHASL                                            71 - 101
//

Text Mined References (15)

PMID Year Title