Property Summary

NCBI Gene PubMed Count 10
Grant Count 8
Funding $4,948,261.82
PubMed Score 6.02
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.300 0.000
lung cancer -3.100 0.000
group 4 medulloblastoma -1.500 0.001
lung carcinoma -1.400 0.000
Down syndrome 1.600 0.001
dermatomyositis -1.200 0.000

Gene RIF (3)

PMID Text
20457939 show that MIG12, a 22 kDa cytosolic protein of previously unknown function, binds to acetyl-CoA carboxylase and lowers the threshold for citrate activation into the physiological range.
18854154 Knockdown of MID1 interacting protein 1 (MID1IP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MID1 interacting protein 1 (MID1IP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV      1 - 70
PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE     71 - 140
EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH                               141 - 183
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20457939 2010 Induced polymerization of mammalian acetyl-CoA carboxylase by MIG12 provides a tertiary level of regulation of fatty acid synthesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15070402 2004 Mig12, a novel Opitz syndrome gene product partner, is expressed in the embryonic ventral midline and co-operates with Mid1 to bundle and stabilize microtubules.
More...