Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.48
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis -1.200 2.6e-04
Down syndrome 1.600 5.7e-04
group 4 medulloblastoma -1.500 1.1e-03
lung cancer -2.600 1.9e-04
lung carcinoma -1.400 1.2e-17
psoriasis -2.300 5.0e-05

Gene RIF (4)

AA Sequence

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV      1 - 70
PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE     71 - 140
EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH                               141 - 183
//

Text Mined References (13)

PMID Year Title