Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.75
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.475 0.000
pancreatic ductal adenocarcinoma liver m... -1.258 0.025
Breast cancer 2.500 0.031
ovarian cancer 3.000 0.000
dermatomyositis 1.200 0.002

Synonym

Accession Q9NPA0 B2RC00 Q96ED5
Symbols HT022
C11orf3
C15orf24
ORF1-FL1

Gene

PDB

1B0G   1LP9   2J8U   2JCC   2UWE  

 GO Function (1)

Gene RIF (1)

PMID Text
17165166 Candidate modifier gene on the phenotypic expression of hypertrophy in patients with hyperthophic cardiomyopathy.

AA Sequence

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVD      1 - 70
GEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQM     71 - 140
KSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDV    141 - 210
SEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR                                          211 - 242
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17825839 2007 Single MHC mutation eliminates enthalpy associated with T cell receptor binding.
17165166 2006 [Familial hypertrophic cardiomyopathy--a case report].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...