Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.75
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.500 3.1e-02
dermatomyositis 1.200 1.8e-03
Multiple myeloma 2.475 5.6e-05
ovarian cancer -1.300 3.5e-04
pancreatic ductal adenocarcinoma liver m... -1.258 2.5e-02

Synonym

Accession Q9NPA0 B2RC00 Q96ED5
Symbols HT022
C11orf3
C15orf24
ORF1-FL1

Gene

PDB

1B0G   1LP9   2J8U   2JCC   2UWE  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (1)

AA Sequence

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVD      1 - 70
GEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQM     71 - 140
KSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDV    141 - 210
SEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR                                          211 - 242
//

Text Mined References (11)

PMID Year Title