Property Summary

NCBI Gene PubMed Count 126
PubMed Score 314.28
PubTator Score 206.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver diseases 66
Disease Target Count P-value
lung carcinoma 2844 6.76573434180311E-38
psoriasis 6685 1.38622321742404E-28
non-small cell lung cancer 2798 2.10665533605824E-13
lung adenocarcinoma 2714 7.95675592258212E-7
posterior fossa group A ependymoma 1511 1.20277548373929E-6
lung cancer 4473 2.09468453984192E-6
pancreatic cancer 2300 3.35659209164175E-5
adult high grade glioma 2148 2.59402136145597E-4
atypical teratoid / rhabdoid tumor 4369 0.00276951625329933
pilocytic astrocytoma 3086 0.00359323959614737
interstitial cystitis 2299 0.00421398824729902
cutaneous lupus erythematosus 1056 0.004993678939495
ulcerative colitis 2087 0.00530712926237955
tuberculosis 1563 0.00653233036702955
glioblastoma 5572 0.00868841170863138
invasive ductal carcinoma 2950 0.0286818718510991
sarcoidosis 368 0.0327272334110225
pituitary cancer 1972 0.0347208637533519
Disease Target Count Z-score Confidence
Pneumonia 133 4.77 2.4

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.005
glioblastoma 1.500 0.009
posterior fossa group A ependymoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.200 0.003
tuberculosis -1.600 0.007
non-small cell lung cancer -2.403 0.000
lung cancer -4.100 0.000
sarcoidosis -1.200 0.033
pancreatic cancer 1.600 0.000
interstitial cystitis 1.100 0.004
lung adenocarcinoma -1.300 0.000
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.200 0.004
lung carcinoma -4.400 0.000
invasive ductal carcinoma 1.100 0.029
ulcerative colitis 1.700 0.005
pituitary cancer -1.300 0.035
psoriasis 2.100 0.000

Synonym

Accession Q9NP99 B4DWG2 K7EJW1 Q53FL8 Q5T2C9 Q86YU1 TREM-1
Symbols CD354
TREM-1

Gene

PDB

1Q8M   1SMO  

  Ortholog (7)

Gene RIF (116)

PMID Text
27324541 TREM-1 activation may be involved in the development of Kawasaki disease.
27096761 The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases.
26963514 TREM-1 and Dectin-1 function concurrently in the corneal innate immune response by regulating inflammatory cytokine expression in fungal keratitis.
26495896 Soluble TREM-1 level is significantly increased in hemodialysis patients as are other pro-inflammatory markers.
26397033 LPS-induced TREM-1 transcription.
26384438 study to determine soluble TREM-1 and TREM-2 levels in serum, and membrane-bound TREM-1 and TREM-2 on peripheral blood mononuclear cells of patients with pulmonary TB
26320130 TREM-1 is induced by MSU and is associated with the inflammation of human acute gouty arthritis.
26281323 TREM-1 is a member of the immunoglobulin superfamily released from phagocytic cells in the presence of bacterial and fungal infections.
26184544 Report altered TREM-1/TREM-2 ratio in cutaneous melanoma.
25944130 Plasma and urine TREM-1 levels can be used as diagnostic biomarkers for acute kidney injury in critically ill patients with sepsis.
More...

AA Sequence

MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACT      1 - 70
ERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGT     71 - 140
PGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILL    141 - 210
AGGFLSKSLVFSVLFAVTLRSFVP                                                  211 - 234
//

Text Mined References (128)

PMID Year Title
27324541 2016 [Role of triggering receptor expressed on myeloid cells-1 in the pathogenesis of Kawasaki disease].
27096761 2016 Prospective Evaluation of Procalcitonin, Soluble Triggering Receptor Expressed on Myeloid Cells-1 and C-Reactive Protein in Febrile Patients with Autoimmune Diseases.
26963514 2016 Inhibition of TREM-1 and Dectin-1 Alleviates the Severity of Fungal Keratitis by Modulating Innate Immune Responses.
26495896 2015 sTREM-1 in patients with chronic kidney disease on hemodialysis.
26397033 2015 Evaluation of the lipopolysaccharide-induced transcription of the human TREM-1 gene in vitamin D3-matured THP-1 macrophage-like cells.
26384438 2015 Soluble and cell-associated triggering receptor expressed on myeloid cells-1 and -2 in patients with pulmonary tuberculosis.
26320130 2016 Monosodium urate crystal-induced triggering receptor expressed on myeloid cells 1 is associated with acute gouty inflammation.
26281323 2015 Diagnostic and prognostic value of procalcitonin and sTREM-1 levels in sepsis.
26184544 2015 Triggering Receptor Expressed on Myeloid Cells in Cutaneous Melanoma.
25944130 2015 Diagnostic value of neutrophil gelatinase-associated lipocalin, cystatin C, and soluble triggering receptor expressed on myeloid cells-1 in critically ill patients with sepsis-associated acute kidney injury.
More...