Property Summary

NCBI Gene PubMed Count 16
PubMed Score 17.80
PubTator Score 14.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Myopathy 185 3.22 1.6
Atrial Fibrillation 124 3.061 1.5

Expression

Gene RIF (6)

AA Sequence

MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF      1 - 70
IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG     71 - 140
AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG    141 - 210
AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE    211 - 280
PVDYNVDIGIPLDGETEEL                                                       281 - 299
//

Text Mined References (16)

PMID Year Title