Property Summary

NCBI Gene PubMed Count 29
PubMed Score 163.20
PubTator Score 43.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.49822396331178E-5
psoriasis 6685 9.82601675747089E-5
osteosarcoma 7933 3.43881794009853E-4
Multiple myeloma 1328 5.13922567362127E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00215173164040165
Disease Target Count Z-score Confidence
Carrion's Disease 6 3.582 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.037 0.001
psoriasis -1.400 0.000
osteosarcoma -1.389 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.002
ovarian cancer 2.300 0.000

Synonym

Accession Q9NP97 B1AKR5 Q5TC72 Q96IV3 Q9NQM2
Symbols BLP
BITH
DNCL2A
DNLC2A
ROBLD1

Gene

PDB

1Z09   2B95   2E8J   2HZ5  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 MGI Term (1)

Gene RIF (10)

PMID Text
23755307 Human colorectal carcinoma cells display decreased tumor progression and invasion when a novel anti-cell motility target, DYNLRB1, is being silenced.
23333499 TGFbeta regulates km23-1 interaction with the R1beta regulatory subunit of protein kinase A.
23079622 these findings demonstrate that km23-1 regulates RhoA and motility-associated actin modulating proteins, suggesting that km23-1 may represent a novel target for anti-metastatic therapy.
22637579 km23-1 is required for TGFbeta1 autoinduction through Smad2-independent Ras/ERK/JNK pathways
19711352 Findings indicate that km23-2 (DYNLRB2) is required for Smad3-dependent TGFbeta signaling. Km23-2 has functions in TGFbeta signaling that are distinct from those for km23-1 (DYNLRB1).
19571232 Identification of dynein light chain road block-1 as a novel interaction partner with the human reduced folate carrier.
18044744 DYNLRB1 specifically interacts with all three Rab6 isoforms and co-localises at the Golgi.
17556076 Infrequently mutated in human colorectal and gastric cancers.
16970917 report the 2.1-A crystal structure of Dnlc2A using single anomalous diffraction
16778097 Silencing of km23, either through somatic genetic mutation or promoter hypermethylation, is rare in ovarian, breast, and colorectal cancers.

AA Sequence

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR      1 - 70
IRSKKNEIMVAPDKDYFLIVIQNPTE                                                 71 - 96
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23755307 2013 Decreased tumor progression and invasion by a novel anti-cell motility target for human colorectal carcinoma cells.
23333499 2013 Requirement for protein kinase A in the phosphorylation of the TGF? receptor-interacting protein km23-1 as a component of TGF? downstream effects.
23079622 2012 Role of km23-1 in RhoA/actin-based cell migration.
22637579 2012 The TGF? receptor-interacting protein km23-1/DYNLRB1 plays an adaptor role in TGF?1 autoinduction via its association with Ras.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19711352 2009 Requirement of a dynein light chain in TGFbeta/Smad3 signaling.
More...