Property Summary

NCBI Gene PubMed Count 35
Grant Count 14
R01 Count 6
Funding $2,015,237.9
PubMed Score 53.05
PubTator Score 46.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 4.700 0.000

Gene RIF (27)

PMID Text
26070653 The results of this study indicated that rs12720208 may contribute to the risk of PD in Iranian population.
25030126 Meta-analysis suggests that FGF20 rs1721100 C/G polymorphism is associated with sporadic sporadic Parkinson's diseases in Asians
24942208 The meta-analysis showed an association between FGF20 gene rs1721100 polymorphism and risk of Parkinson's disease under a recessive model.
23938014 The results showed no significant differences in the presence of rs1721100 or rs12720208 in the FGF20 gene between Parkinson's disease patients and controls.
23516905 The results have not shown any effect of rs12720208 in the FGF20 gene on the risk of Parkinson's disease in patients residing in Russia
22698282 The data suggested that Fgf9/20 and Bmp7 organize the nephron progenitor niche and highlight the essential role of FGF20 in human kidney development. FGF signaling likely regulates multiple important steps in the stem cell niche.
22342445 This study revealed that the rs1721100(C/G) polymorphism is a risk factor for PD in Han Chinese population, while rs12720208(C/T) polymorphism is not significantly associated with Parkinson's disease.
20471450 The common FGF20 rs12720208 SNP was not associated with the risk for Parkinson's disease (PD) in our population. In addition, we did not find nucleotide changes in miR-433 (that binds to the 3' UTR FGF20 mRNA) among our PD patients.
20471450 Observational study of gene-disease association. (HuGE Navigator)
20427658 The associations described, from mRNA expression to brain morphology to cognition and an interaction with aging, confirm a role of FGF20 in human brain structure and function during development and aging.
More...

AA Sequence

MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLY      1 - 70
CRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFR     71 - 140
EQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMY    141 - 210
T//

Text Mined References (37)

PMID Year Title
26070653 2015 Variation in the miRNA-433 binding site of FGF20 is a risk factor for Parkinson's disease in Iranian population.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
25030126 2015 Quantitative assessment of the association between fibroblast growth factor 20 rs1721100 C/G polymorphism and the risk of sporadic Parkinson's diseases: a meta-analysis.
24942208 2014 Fibroblast growth factor 20 (FGF20) gene polymorphism and risk of Parkinson's disease: a meta-analysis.
24157794 2013 Dynamic modulation of FGFR1-5-HT1A heteroreceptor complexes. Agonist treatment enhances participation of FGFR1 and 5-HT1A homodimers and recruitment of ?-arrestin2.
23938014 2013 Fibroblast growth factor 20 polymorphism in sporadic Parkinson's disease in Northern Han Chinese.
23516905 2012 [Analysis of the rs12720208 single-nucleotide polymorphism of the FGF20 gene in Russian patients with sporadic Parkinson's disease].
22698282 2012 FGF9 and FGF20 maintain the stemness of nephron progenitors in mice and man.
22342445 2012 Fibroblast growth factor 20 (FGF20) polymorphism is a risk factor for Parkinson's disease in Chinese population.
More...