Property Summary

NCBI Gene PubMed Count 38
PubMed Score 55.29
PubTator Score 46.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 3.700 3.8e-05

Synonym

Accession Q9NP95 B2RPH5 FGF-20
Symbols RHDA2
FGF-20

Gene

PANTHER Protein Class (2)

PDB

3F1R  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (30)

AA Sequence

MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLY      1 - 70
CRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFR     71 - 140
EQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMY    141 - 210
T//

Text Mined References (40)

PMID Year Title