Property Summary

NCBI Gene PubMed Count 34
Grant Count 7
R01 Count 5
Funding $357,053.02
PubMed Score 40.14
PubTator Score 32.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.021

Gene RIF (14)

PMID Text
26643924 ZIP2 Gln/Arg/Leu polymorphism involve in proinflammatory mediation and zinc homeostasis in elderly population with a more pronounced anti-inflammatory effect of zinc supplementation in subjects carrying ZIP2 Leu- (Arg43Arg) genotype
24936057 results of this study suggest that ZIP2, a zinc transporter expressed specifically in the epidermis, and zinc taken up by ZIP2 are necessary for the differentiation of keratinocytes
23921484 Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls.
23686108 Increased expression of Zip2 gene is closely associated with immunity of pulmonary tuberculosis patients, suggesting that the Zip2 gene may play a key role in initial infection control.
21603979 Expression of two Zn2+ influx transporters, ZIP2 and ZIP4, is reduced as a function of retinal pigment epithelium age.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18328005 Zip2 Gln/Arg/Leu polymorphism plays a role in the susceptibility to carotid artery disease.
More...

AA Sequence

MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALE      1 - 70
EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLESLALQCCPGAAGGSTVQDEE     71 - 140
WGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEGLAVGLQPTVAATVQLCLAVLAHKGLVVFGV    141 - 210
GMRLVHLGTSSRWAVFSILLLALMSPLGLAVGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPR    211 - 280
ELASPEAPLAKWSCVAAGFAFMAFIALWA                                             281 - 309
//

Text Mined References (36)

PMID Year Title
26643924 Effect of ZIP2 Gln/Arg/Leu (rs2234632) polymorphism on zinc homeostasis and inflammatory response following zinc supplementation.
24936057 2014 ZIP2 protein, a zinc transporter, is associated with keratinocyte differentiation.
23921484 2013 Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature.
23686108 2013 Up-regulation of Slc39A2(Zip2) mRNA in peripheral blood mononuclear cells from patients with pulmonary tuberculosis.
22209006 2012 Comparison of intracellular zinc signals in nonadherent lymphocytes from young-adult and elderly donors: role of zinc transporters (Zip family) and proinflammatory cytokines.
22079192 2011 Intrathecally synthesized IgG in multiple sclerosis cerebrospinal fluid recognizes identical epitopes over time.
21947419 2012 SLC39A2 and FSIP1 polymorphisms as potential modifiers of arsenic-related bladder cancer.
21603979 2012 ZIP2 and ZIP4 mediate age-related zinc fluxes across the retinal pigment epithelium.
21508100 2011 Endogenic regulation of proliferation and zinc transporters by pigment epithelial cells nonvirally transfected with PEDF.
20148757 2010 Intensive therapies for mantle cell lymphoma: time for a disease-specific approach?
More...