Tbio | Zinc transporter ZIP2 |
Mediates zinc uptake. Zinc uptake may be mediated by a Zn(2+)-HCO(3)(-) symport mechanism and can function in the presence of albumin. May also transport other divalent cations. May be important in contact inhibition of normal epithelial cells and loss of its expression may play a role in tumorigenesis.
This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been described. [provided by RefSeq, Mar 2010]
This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been described. [provided by RefSeq, Mar 2010]
Comments
Disease | Target Count | P-value |
---|---|---|
esophageal adenocarcinoma | 737 | 0.0212241268851329 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Acrodermatitis enteropathica | 18 | 3.361 | 1.7 |
Bethlem myopathy | 5 | 3.165 | 1.6 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26643924 | ZIP2 Gln/Arg/Leu polymorphism involve in proinflammatory mediation and zinc homeostasis in elderly population with a more pronounced anti-inflammatory effect of zinc supplementation in subjects carrying ZIP2 Leu- (Arg43Arg) genotype |
24936057 | results of this study suggest that ZIP2, a zinc transporter expressed specifically in the epidermis, and zinc taken up by ZIP2 are necessary for the differentiation of keratinocytes |
23921484 | Data indicate that the average expression level of zinc transporter Zip2 was significantly higher and zinc transporters Zip6, Zip8 mRNA levels were significantly lower in short stature children than in health controls. |
23686108 | Increased expression of Zip2 gene is closely associated with immunity of pulmonary tuberculosis patients, suggesting that the Zip2 gene may play a key role in initial infection control. |
21603979 | Expression of two Zn2+ influx transporters, ZIP2 and ZIP4, is reduced as a function of retinal pigment epithelium age. |
19692168 | Observational study of gene-disease association. (HuGE Navigator) |
19625176 | Observational study of gene-disease association. (HuGE Navigator) |
19170196 | Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) |
18676680 | Observational study of gene-disease association. (HuGE Navigator) |
18328005 | Zip2 Gln/Arg/Leu polymorphism plays a role in the susceptibility to carotid artery disease. |
More... |
MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALE 1 - 70 EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLESLALQCCPGAAGGSTVQDEE 71 - 140 WGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEGLAVGLQPTVAATVQLCLAVLAHKGLVVFGV 141 - 210 GMRLVHLGTSSRWAVFSILLLALMSPLGLAVGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPR 211 - 280 ELASPEAPLAKWSCVAAGFAFMAFIALWA 281 - 309 //
PMID | Year | Title |
---|---|---|
26643924 | Effect of ZIP2 Gln/Arg/Leu (rs2234632) polymorphism on zinc homeostasis and inflammatory response following zinc supplementation. | |
24936057 | 2014 | ZIP2 protein, a zinc transporter, is associated with keratinocyte differentiation. |
23921484 | 2013 | Zip1, Zip2, and Zip8 mRNA expressions were associated with growth hormone level during the growth hormone provocation test in children with short stature. |
23686108 | 2013 | Up-regulation of Slc39A2(Zip2) mRNA in peripheral blood mononuclear cells from patients with pulmonary tuberculosis. |
22209006 | 2012 | Comparison of intracellular zinc signals in nonadherent lymphocytes from young-adult and elderly donors: role of zinc transporters (Zip family) and proinflammatory cytokines. |
22079192 | 2011 | Intrathecally synthesized IgG in multiple sclerosis cerebrospinal fluid recognizes identical epitopes over time. |
21947419 | 2012 | SLC39A2 and FSIP1 polymorphisms as potential modifiers of arsenic-related bladder cancer. |
21603979 | 2012 | ZIP2 and ZIP4 mediate age-related zinc fluxes across the retinal pigment epithelium. |
21508100 | 2011 | Endogenic regulation of proliferation and zinc transporters by pigment epithelial cells nonvirally transfected with PEDF. |
20148757 | 2010 | Intensive therapies for mantle cell lymphoma: time for a disease-specific approach? |
More... |