Property Summary

NCBI Gene PubMed Count 34
PubMed Score 41.45
PubTator Score 32.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
esophageal adenocarcinoma 737 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acrodermatitis enteropathica 18 3.314 1.7
Bethlem myopathy 6 3.112 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
esophageal adenocarcinoma -1.200 2.1e-02

Gene RIF (14)

AA Sequence

MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALE      1 - 70
EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLESLALQCCPGAAGGSTVQDEE     71 - 140
WGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEGLAVGLQPTVAATVQLCLAVLAHKGLVVFGV    141 - 210
GMRLVHLGTSSRWAVFSILLLALMSPLGLAVGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPR    211 - 280
ELASPEAPLAKWSCVAAGFAFMAFIALWA                                             281 - 309
//

Text Mined References (36)

PMID Year Title