Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.82
PubTator Score 9.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.2e-03
Multiple myeloma 1.042 1.8e-02
malignant mesothelioma 1.200 1.0e-06
astrocytic glioma -1.400 2.4e-02
psoriasis -2.400 2.2e-05
osteosarcoma 2.411 3.2e-06
atypical teratoid / rhabdoid tumor -1.100 2.8e-03
glioblastoma -1.300 7.3e-05
medulloblastoma, large-cell -1.100 6.6e-04
tuberculosis and treatment for 6 months -1.300 6.7e-05
non-small cell lung cancer 1.388 1.2e-18
lung cancer 2.100 1.1e-03
Breast cancer 3.800 2.6e-02
adult high grade glioma -1.200 7.6e-04
breast carcinoma 1.100 2.5e-17
Pick disease 1.300 3.9e-04
ovarian cancer 1.800 6.4e-05

Synonym

Accession Q9NP92 Q96I91 Q96Q19 Q9H0P8 Q9NSF9 Q9NZ76 MRP-S30
Symbols PAP
PDCD9
S30mt
MRP-S30

Gene

PDB

3J9M   3J7Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
24528085 Among the 10 SNPs studied, rs10941679 in MRPS30 showed significant association with breast cancer risk when differences between the case and control groups in this Han Chinese population were compared.
24388359 data suggest the 5p12 risk allele affects MRPS30 expression in estrogen-responsive tumor cells after tumor initiation by a mechanism affecting chromatin availability.
24388359 The risk-associated allele of rs7716600 in the 5p12 ER-positive susceptibility locus was associated with elevated expression of the nearby gene MRPS30 and decreased MRPS30 promoter methylation exclusively in ER-positive tumors. eQTL and in vitro experiments suggest this allele affects MRPS30 expression in estrogen-responsive tumor cells after tumor initiation by a mechanism affecting chromatin availability.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19789366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATV      1 - 70
HAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLA     71 - 140
ALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYW    141 - 210
VRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYEN    211 - 280
HIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEAD    281 - 350
VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ    351 - 420
IVHFLLNRPKEEKSQLLEN                                                       421 - 439
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24528085 2014 Breast cancer association studies in a Han Chinese population using 10 European-ancestry-associated breast cancer susceptibility SNPs.
24388359 2014 The 5p12 breast cancer susceptibility locus affects MRPS30 expression in estrogen-receptor positive tumors.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20872241 2011 A combined analysis of genome-wide association studies in breast cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19789366 2009 Evaluation of 11 breast cancer susceptibility loci in African-American women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10640817 1999 Cloning, expression, and mapping of PDCD9, the human homolog of Gallus gallus pro-apoptotic protein p52.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.