Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.82
PubTator Score 9.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
Multiple myeloma 1.042 0.018
malignant mesothelioma 1.200 0.000
astrocytic glioma -1.400 0.024
psoriasis -2.400 0.000
osteosarcoma 2.411 0.000
atypical teratoid / rhabdoid tumor -1.100 0.003
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.100 0.001
tuberculosis and treatment for 6 months -1.300 0.000
non-small cell lung cancer 1.388 0.000
lung cancer 2.100 0.001
Breast cancer 3.800 0.026
adult high grade glioma -1.200 0.001
breast carcinoma 1.100 0.000
Pick disease 1.300 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9NP92 Q96I91 Q96Q19 Q9H0P8 Q9NSF9 Q9NZ76 MRP-S30
Symbols PAP
PDCD9
S30mt
MRP-S30

Gene

PDB

3J9M   3J7Y  

Gene RIF (6)

PMID Text
24528085 Among the 10 SNPs studied, rs10941679 in MRPS30 showed significant association with breast cancer risk when differences between the case and control groups in this Han Chinese population were compared.
24388359 data suggest the 5p12 risk allele affects MRPS30 expression in estrogen-responsive tumor cells after tumor initiation by a mechanism affecting chromatin availability.
24388359 The risk-associated allele of rs7716600 in the 5p12 ER-positive susceptibility locus was associated with elevated expression of the nearby gene MRPS30 and decreased MRPS30 promoter methylation exclusively in ER-positive tumors. eQTL and in vitro experiments suggest this allele affects MRPS30 expression in estrogen-responsive tumor cells after tumor initiation by a mechanism affecting chromatin availability.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19789366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATV      1 - 70
HAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLA     71 - 140
ALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYW    141 - 210
VRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYEN    211 - 280
HIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEAD    281 - 350
VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ    351 - 420
IVHFLLNRPKEEKSQLLEN                                                       421 - 439
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24528085 2014 Breast cancer association studies in a Han Chinese population using 10 European-ancestry-associated breast cancer susceptibility SNPs.
24388359 2014 The 5p12 breast cancer susceptibility locus affects MRPS30 expression in estrogen-receptor positive tumors.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20872241 2011 A combined analysis of genome-wide association studies in breast cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19789366 2009 Evaluation of 11 breast cancer susceptibility loci in African-American women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...