Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.42
PubTator Score 9.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 3.800 2.6e-02
adult high grade glioma -1.200 7.6e-04
astrocytic glioma -1.400 2.4e-02
atypical teratoid / rhabdoid tumor -1.100 2.8e-03
breast carcinoma 1.100 2.5e-17
glioblastoma -1.300 7.3e-05
hepatocellular carcinoma 1.100 1.2e-03
lung cancer 1.600 2.6e-04
malignant mesothelioma 1.200 1.0e-06
medulloblastoma, large-cell -1.100 6.6e-04
Multiple myeloma 1.042 1.8e-02
non-small cell lung cancer 1.388 1.2e-18
osteosarcoma 2.411 3.2e-06
ovarian cancer -1.500 1.2e-05
Pick disease 1.300 3.9e-04
psoriasis -2.400 2.2e-05
tuberculosis and treatment for 6 months -1.300 6.7e-05

Gene RIF (7)

AA Sequence

MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATV      1 - 70
HAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLA     71 - 140
ALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYW    141 - 210
VRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYEN    211 - 280
HIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEAD    281 - 350
VTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ    351 - 420
IVHFLLNRPKEEKSQLLEN                                                       421 - 439
//

Text Mined References (24)

PMID Year Title