Property Summary

NCBI Gene PubMed Count 17
PubMed Score 34.44
PubTator Score 11.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.102 4.0e-02
active ulcerative colitis 3.476 4.6e-03
atypical teratoid/rhabdoid tumor 1.300 3.6e-02
colon cancer 2.900 5.5e-03
facioscapulohumeral dystrophy 2.600 1.7e-04

Gene RIF (5)

AA Sequence

MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLELAVGQRMR      1 - 70
QGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSVCPLNGNHTGYDEECE     71 - 140
KASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLVVYLCILRGTESTGKVVYFTASLPYCVLIIY    141 - 210
LIRGLTLHGATNGLMYMFTPKIEQLANPKAWINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVS    211 - 280
LINSFTSIFASIVTFSIYGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSE    281 - 350
MFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD    351 - 420
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAVCYVYGLRRFE    421 - 490
SDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWDASQGQLVTKDYPAYALAVIG    491 - 560
LLVASSTMCIPLAALGTFVQRRLKRGDADPVA                                          561 - 592
//

Text Mined References (18)

PMID Year Title