Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $289,898.6
PubMed Score 31.01
PubTator Score 11.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 2.900 0.005
active Crohn's disease 1.102 0.040
active ulcerative colitis 3.476 0.005
atypical teratoid/rhabdoid tumor 1.300 0.036
facioscapulohumeral dystrophy 2.600 0.000

Synonym

Accession Q9NP91 A1A4F2 O75590 Q8TF10 Q9NPQ2 Q9NQ77
Symbols XT3
SIT1
Xtrp3

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (5)

PMID Text
26049783 Imputed meta-analysis revealed that 13 SLC6A20 SNPs were significantly associated with Hirschsprung disease. In further subgroup analysis, SLC6A20 polymorphisms appeared to have increased associations with Long-Segment Hirschsprung disease.
25534429 SIT1, B(0)AT1 and ACE2 were co-localized in the brush-border membrane of small intestine enterocytes.
24958070 genetic association studies in two populations, European/Rotterdam and Chinese Han/Shanghai: Data suggest that an SNP in SLC6A20 (rs13062383) is associated with predisposition of type 2 diabetes. [META-ANALYSIS]
23333304 HIV-1 Vif downregulates the expression of solute carrier family 6, member 20 (SLC6A20) in Vif-expression T cells
19657969 Using homology modeling we identified two highly conserved Na(+)-binding sites and a putative Cl(-)-binding site of SLC6A20.

AA Sequence

MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLELAVGQRMR      1 - 70
QGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSVCPLNGNHTGYDEECE     71 - 140
KASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLVVYLCILRGTESTGKVVYFTASLPYCVLIIY    141 - 210
LIRGLTLHGATNGLMYMFTPKIEQLANPKAWINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVS    211 - 280
LINSFTSIFASIVTFSIYGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSE    281 - 350
MFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD    351 - 420
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAVCYVYGLRRFE    421 - 490
SDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWDASQGQLVTKDYPAYALAVIG    491 - 560
LLVASSTMCIPLAALGTFVQRRLKRGDADPVA                                          561 - 592
//

Text Mined References (18)

PMID Year Title
26049783 2016 Association Analysis of SLC6A20 Polymorphisms With Hirschsprung Disease.
25534429 2015 Human intestine luminal ACE2 and amino acid transporter expression increased by ACE-inhibitors.
25416956 2014 A proteome-scale map of the human interactome network.
25310821 2014 A genome-wide association study identifies potential susceptibility loci for Hirschsprung disease.
24958070 2014 A genetic variant in SLC6A20 is associated with Type 2 diabetes in white-European and Chinese populations.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24816252 2014 An atlas of genetic influences on human blood metabolites.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21572414 2011 A genome-wide association study of metabolic traits in human urine.
19657969 2009 Sodium translocation by the iminoglycinuria associated imino transporter (SLC6A20).
More...