Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.52
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.13987634026081E-46
atypical teratoid / rhabdoid tumor 4369 2.96879839482311E-6
medulloblastoma, large-cell 6234 3.1366889865233E-6
glioblastoma 5572 0.00198255306069353
pediatric high grade glioma 2712 0.0023287931968621
astrocytic glioma 2241 0.0116922066133774
ependymoma 2514 0.0177557037216994
subependymal giant cell astrocytoma 2287 0.047715509216804
Disease Target Count Z-score Confidence
Pelizaeus-Merzbacher disease 20 3.991 2.0
Cerebral palsy 28 3.019 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 0.012
ependymoma -2.000 0.018
atypical teratoid / rhabdoid tumor -2.400 0.000
glioblastoma -1.500 0.002
medulloblastoma, large-cell -2.600 0.000
pediatric high grade glioma -1.100 0.002
subependymal giant cell astrocytoma -1.514 0.048
psoriasis -1.300 0.000

Synonym

Accession Q9NP90 B2R8M0 Q52LX2
Symbols RAB9L
Rab-9L

Gene

PDB

2OCB  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

 GO Function (2)

Gene RIF (3)

PMID Text
20459747 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells
20012524 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells
16140752 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells

AA Sequence

MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK      1 - 70
SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT     71 - 140
WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC             141 - 201
//

Text Mined References (13)

PMID Year Title
22637480 2012 RUTBC2 protein, a Rab9A effector and GTPase-activating protein for Rab36.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20048159 2010 Assembly of the biogenesis of lysosome-related organelles complex-3 (BLOC-3) and its interaction with Rab9.
19490898 2009 RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204133 2005 Prediction of regulatory modules comprising microRNAs and target genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...