Property Summary

NCBI Gene PubMed Count 29
Grant Count 91
R01 Count 61
Funding $12,093,736.03
PubMed Score 199.26
PubTator Score 65.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.331 1.7

Expression

Synonym

Accession Q9NP87 D3DVK4 Q6P5X8 Q86WQ9 Pol Mu
Symbols Tdt-N
Pol Mu

Gene

PDB

2DUN   2HTF   4LZD   4LZG   4M04   4M0A   4YCX   4YD1   4YD2  

Gene RIF (23)

PMID Text
26240373 analysis of template-dependent synthesis by human polymerase mu
24878922 A study of how Polmu fixes and/or orients the mobile Loop1 part of the protein in accordance with the substrate on which it is polymerizing.
24487959 specific loop 1 residues contribute to Pol mu's unique ability to catalyze template-dependent NHEJ of DSBs with unpaired 3' ends
23935073 A specific N-terminal extension of the 8 kDa domain of DNA polymerase mu is potentially implicated in the maintenance of a closed conformation throughout the catalytic cycle, and this study indicated that it could be a target of Cdk phosphorylation.
23933132 evidence suggests that Polmu could be regulated in vivo by phosphorylation of the BRCT domain (Ser12/Thr21) and of Ser372, affecting the function of loop1; Polmu's most distinctive activities would be turned off at specific cell-cycle phases (S and G2), when these functions might be harmful to the cell
23275568 A physiological concentration of Mn(2+) ions did benefit Polmicro-mediated non-homologous end joining by improving the efficiency and accuracy of nucleotide insertion.
23143108 The study points at human Polmicro residues His(329) and Arg(387) as responsible for regulating nucleotide expansions occurring during DNA repair transactions, either promoting or blocking, respectively, iterative polymerization.
23034807 The results uncovered a new DNA-binding function for the BRCT domain of Polmicro and demonstrated the importance of several residues located at the primer-binding region, for both DNA-binding and polymerization activities.
22897684 Pol mu binds to DNA through its amino-terminal and pol beta-like regions.
19805281 Studies shed light on the mechanism by which a rate-limited terminal transferase activity in Polmu could regulate the balance between accuracy and necessary efficiency, providing some variability during NHEJ.
More...

AA Sequence

MLPKRRRARVGSPSGDAASSTPPSTRFPGVAIYLVEPRMGRSRRAFLTGLARSKGFRVLDACSSEATHVV      1 - 70
MEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPA     71 - 140
YACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSS    141 - 210
RVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGL    211 - 280
QHHQDLSTPVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRV    281 - 350
MCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLV    351 - 420
VAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPE    421 - 490
QRNA                                                                      491 - 494
//

Text Mined References (39)

PMID Year Title
26240373 2015 Creative template-dependent synthesis by human polymerase mu.
24878922 2014 Decision-making during NHEJ: a network of interactions in human Pol? implicated in substrate recognition and end-bridging.
24487959 2014 Sustained active site rigidity during synthesis by human DNA polymerase ?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935073 2013 A specific N-terminal extension of the 8 kDa domain is required for DNA end-bridging by human Pol? and Pol?.
23933132 2013 The BRCT domain and the specific loop 1 of human Pol? are targets of Cdk2/cyclin A phosphorylation.
23275568 2013 Ribonucleotides and manganese ions improve non-homologous end joining by human Pol?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143108 2013 DNA expansions generated by human Pol? on iterative sequences.
23034807 2012 DNA-binding determinants promoting NHEJ by human Pol?.
More...