1. Home
  2. Targets
  3. calcium-binding protein
  4. intracellular calcium-sensing protein
  5. calmodulin
  6. Calcium-binding protein 5

Tbio Calcium-binding protein 5

Inhibits calcium-dependent inactivation of L-type calcium channel and shifts voltage dependence of activation to more depolarized membrane potentials. Involved in the transmission of light signals (By similarity).

The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009]

 Comments

Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.06
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma, large-cell 6234 5.53592977531043E-4
pancreatic cancer 2300 0.0345539403562465
pancreatic carcinoma 567 0.0345539403562466
group 3 medulloblastoma 2254 0.0478642852484457
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 2.0
Disease Target Count Z-score Confidence
Amebiasis 22 3.995 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.300 0.035
medulloblastoma, large-cell 1.900 0.001
group 3 medulloblastoma 1.600 0.048
pancreatic carcinoma 1.300 0.035

Synonym

Accession Q9NP86 A0AUY4 CaBP5
Symbols CABP3

Gene

CABP5

PANTHER Protein Class (3)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (8)

 HCA RNA Cell Line (3)

Pathway (1)

 UniProt Keyword (7)

Gene RIF (1)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.

AA Sequence 

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI      1 - 70
ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE     71 - 140
RLTPREISEVVREADVNGDGTVDFEEFVKMMSR                                         141 - 173
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785943 2002 Calcium-binding proteins: intracellular sensors from the calmodulin superfamily.
11108966 2000 Ca(2+)-binding proteins in the retina: from discovery to etiology of human disease(1).
10625670 2000 Five members of a novel Ca(2+)-binding protein (CABP) subfamily with similarity to calmodulin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...