Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.90
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 5.5e-04
pancreatic cancer 2398 3.5e-02
pancreatic carcinoma 562 3.5e-02
group 3 medulloblastoma 4104 4.8e-02
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 3.0
Disease Target Count Z-score Confidence
Amebiasis 21 3.96 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.600 4.8e-02
medulloblastoma, large-cell 1.900 5.5e-04
pancreatic cancer 1.300 3.5e-02
pancreatic carcinoma 1.300 3.5e-02

Gene RIF (1)

AA Sequence

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI      1 - 70
ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE     71 - 140
RLTPREISEVVREADVNGDGTVDFEEFVKMMSR                                         141 - 173
//

Text Mined References (11)

PMID Year Title