Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 1
Funding $296,762.5
PubMed Score 5.06
PubTator Score 2.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.300 0.035
medulloblastoma, large-cell 1.900 0.001
group 3 medulloblastoma 1.600 0.048
pancreatic carcinoma 1.300 0.035

Gene RIF (1)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.

AA Sequence

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI      1 - 70
ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE     71 - 140
RLTPREISEVVREADVNGDGTVDFEEFVKMMSR                                         141 - 173
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785943 2002 Calcium-binding proteins: intracellular sensors from the calmodulin superfamily.
11108966 2000 Ca(2+)-binding proteins in the retina: from discovery to etiology of human disease(1).
10625670 2000 Five members of a novel Ca(2+)-binding protein (CABP) subfamily with similarity to calmodulin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
More...