Property Summary

NCBI Gene PubMed Count 100
PubMed Score 160.93
PubTator Score 108.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (91)

AA Sequence

MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA      1 - 70
PPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ                71 - 129
//

Text Mined References (100)

PMID Year Title