Property Summary

NCBI Gene PubMed Count 89
Grant Count 79
R01 Count 61
Funding $7,855,353.63
PubMed Score 142.56
PubTator Score 108.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NP84 D3DUA6 Q9HCS0
Symbols FN14
CD266
TWEAKR

Gene

PDB

2EQP   2KMZ   2RPJ  

Gene RIF (80)

PMID Text
26625141 Activated Fn14 expression increases extracellular matrix synthesis and fibroblast activation. Activation of Fn14 is done by the TGF-beta signaling pathway through the transcription factor SMAD4.
26592249 Fn14 has multiple roles in tumor metastasis. (Review)
26497551 Results indicate that FN14 and GRP94 are prediction/prognosis markers which open up new possibilities for preventing/treating brain metastasis in breast cancer patients.
26446946 Evidence that higher tumor Fn14 expression is required for pharmacodynamic response to the anti-TWEAK monoclonal antibody RG7212 in patients with Fn14-positive solid tumors.
26224570 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 HPV type 16 infections keratinocytes turns from apoptosis to proliferation cycle under FN14 protein influence.
25539934 The first human data to show a transient activation of the TWEAK-Fn14 axis.
25392346 Results indicate that oncogenic Src may contribute to Fn14 overexpression in solid tumors, and that Src mediated cell invasion could potentially be inhibited with Fn14- targeted therapeutics.
25375638 TweakR protein was expressed in about half of human breast cancer samples
25054270 Fn14 modulates cell growth and drug resistance by upregulating Bcl-xl expression through the NF-kappaB pathway.
More...

AA Sequence

MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA      1 - 70
PPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ                71 - 129
//

Text Mined References (89)

PMID Year Title
26625141 2015 Fn14, a Downstream Target of the TGF-? Signaling Pathway, Regulates Fibroblast Activation.
26592249 2015 Fibroblast Growth Factor-Inducible 14: Multiple Roles in Tumor Metastasis.
26497551 2015 FN14 and GRP94 expression are prognostic/predictive biomarkers of brain metastasis outcome that open up new therapeutic strategies.
26446946 2016 Exposure and Tumor Fn14 Expression as Determinants of Pharmacodynamics of the Anti-TWEAK Monoclonal Antibody RG7212 in Patients with Fn14-Positive Solid Tumors.
26224570 2015 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 2015 HPV Type 16 Infection Switches Keratinocytes from Apoptotic to Proliferative Fate under TWEAK/Fn14 Interaction.
25539934 2015 TWEAK-Fn14 pathway activation after exercise in human skeletal muscle: insights from two exercise modes and a time course investigation.
25416956 2014 A proteome-scale map of the human interactome network.
25392346 2015 The TWEAK Receptor Fn14 Is an Src-Inducible Protein and a Positive Regulator of Src-Driven Cell Invasion.
25375638 2014 Predictive gene signature of response to the anti-TweakR mAb PDL192 in patient-derived breast cancer xenografts.
More...