Property Summary

NCBI Gene PubMed Count 23
Grant Count 33
R01 Count 13
Funding $4,469,495.02
PubMed Score 89.98
PubTator Score 14.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (7)

PMID Text
25313821 iPLA2gamma plays an important role in in vivo Thromboxane A2 production accompanied by thrombus formation.
23429536 iPLA2gamma plays a cardioprotective role during the acute stage of Chagas' disease.
23258543 Thus, complement-mediated activation of iPLA(2)gamma is mediated via ERK and p38 pathways, and phosphorylation of Ser-511 and/or Ser-515 plays a key role in the catalytic activity and signaling of iPLA(2)gamma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19892409 Observational study of gene-disease association. (HuGE Navigator)
18680539 iPLA2 activation is not sufficient for SOCE activation. iPLA2 may regulate basal phosphoinositide metabolism
15695510 These results suggest distinct roles for iPLA2beta and iPLA2gamma in cellular homeostasis and signaling, a functional link between peroxisomal AA release and eicosanoid generation, and a potential contribution of iPLA2gamma to tumorigenesis.

AA Sequence

MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKH      1 - 70
CYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVS     71 - 140
DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNH    141 - 210
INSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQ    211 - 280
VSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQR    281 - 350
EKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETL    351 - 420
QAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAF    421 - 490
MLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCP    491 - 560
KVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGL    561 - 630
LLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGL    631 - 700
LPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKT    701 - 770
DMYEGLPFFSKL                                                              771 - 782
//

Text Mined References (27)

PMID Year Title
25512002 2015 Loss of function variants in human PNPLA8 encoding calcium-independent phospholipase A2 ? recapitulate the mitochondriopathy of the homologous null mouse.
25313821 2014 Group VIB calcium-independent phospholipase A2 (iPLA2?) regulates platelet activation, hemostasis and thrombosis in mice.
23527149 2013 Fine mapping for Weaver syndrome in Brown Swiss cattle and the identification of 41 concordant mutations across NRCAM, PNPLA8 and CTTNBP2.
23429536 2013 The absence of myocardial calcium-independent phospholipase A2? results in impaired prostaglandin E2 production and decreased survival in mice with acute Trypanosoma cruzi infection.
23258543 2013 Complement-mediated activation of calcium-independent phospholipase A2?: role of protein kinases and phosphorylation.
22006218 2012 Large-scale genome-wide association study of Asian population reveals genetic factors in FRMD4A and other loci influencing smoking initiation and nicotine dependence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19892409 2010 Schizophrenia: an association study targets phospholipase A2 genes as potential sites of susceptible genes.
19029121 2009 Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions.
18680539 2008 Is calcium-independent phospholipase A2 required for store-operated calcium entry in human platelets?
More...