Property Summary

NCBI Gene PubMed Count 23
PubMed Score 89.50
PubTator Score 14.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.300 8.3e-03
acute quadriplegic myopathy 1.168 8.9e-05
atypical teratoid / rhabdoid tumor -1.300 1.7e-05
Breast cancer 2.900 2.4e-02
medulloblastoma, large-cell -1.400 3.7e-04
osteosarcoma 2.103 5.3e-06
ovarian cancer 1.500 1.3e-05
primary pancreatic ductal adenocarcinoma 1.115 2.9e-02
sonic hedgehog group medulloblastoma -1.100 5.0e-05

Gene RIF (7)

AA Sequence

MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKH      1 - 70
CYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVS     71 - 140
DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNH    141 - 210
INSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQ    211 - 280
VSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQR    281 - 350
EKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETL    351 - 420
QAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAF    421 - 490
MLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCP    491 - 560
KVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGL    561 - 630
LLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGL    631 - 700
LPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKT    701 - 770
DMYEGLPFFSKL                                                              771 - 782
//

Text Mined References (27)

PMID Year Title