Property Summary

NCBI Gene PubMed Count 31
Grant Count 13
R01 Count 10
Funding $1,158,505.81
PubMed Score 35.53
PubTator Score 18.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.200 0.000
oligodendroglioma -1.100 0.001
atypical teratoid/rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.200 0.000
primary Sjogren syndrome 1.300 0.000
aldosterone-producing adenoma -1.015 0.025
ovarian cancer -1.100 0.000

 GO Function (1)

Gene RIF (6)

PMID Text
25657007 Crystal structures of three molecular complexes reveal that IST1 binds to the MIT domains of VPS4 and LIP5.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
25164817 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 alpha7 and alpha9 subunits to stimulate ATP hydrolysis.
23105106 the tandem MIT domain of LIP5 binds different types of ESCRT-III proteins, promoting assembly of active VPS4 enzymes on the polymeric ESCRT-III substrate.
21060863 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20358264 LIP5 protein expression in a mouse tissue panel and various rodent and human tissues were studied.

AA Sequence

MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL      1 - 70
KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK     71 - 140
HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT    141 - 210
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG    211 - 280
SALQYEDVSTAVQNLQKALKLLTTGRE                                               281 - 307
//

Text Mined References (36)

PMID Year Title
25657007 2015 Distinct mechanisms of recognizing endosomal sorting complex required for transport III (ESCRT-III) protein IST1 by different microtubule interacting and trafficking (MIT) domains.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25164817 2014 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 ?7 and ?9 to stimulate ATP hydrolysis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21269460 2011 Initial characterization of the human central proteome.
More...