Property Summary

NCBI Gene PubMed Count 32
PubMed Score 39.05
PubTator Score 18.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.015 2.5e-02
atypical teratoid / rhabdoid tumor -1.100 1.1e-05
ependymoma -1.100 1.3e-03
glioblastoma -1.200 6.3e-04
medulloblastoma, large-cell -1.200 1.7e-04
oligodendroglioma -1.100 6.9e-04
ovarian cancer -1.100 2.7e-06
primary Sjogren syndrome 1.300 4.6e-04

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL      1 - 70
KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK     71 - 140
HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT    141 - 210
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG    211 - 280
SALQYEDVSTAVQNLQKALKLLTTGRE                                               281 - 307
//

Text Mined References (37)

PMID Year Title