Property Summary

NCBI Gene PubMed Count 33
PubMed Score 41.31
PubTator Score 30.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 9.87823944637084E-8
atypical teratoid/rhabdoid tumor 1095 3.16329188191408E-7
pilocytic astrocytoma 3086 1.55665385174853E-6
osteosarcoma 7933 6.79569087683611E-6
medulloblastoma, large-cell 6234 3.40489265892292E-5
primitive neuroectodermal tumor 3031 0.00164502797603989
astrocytic glioma 2241 0.00393282517695119
Disease Target Count Z-score Confidence
Acute Promyelocytic Leukemia 32 4.289 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 0.004
osteosarcoma -1.233 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.002
pilocytic astrocytoma -1.300 0.000

Synonym

Accession Q9NP78 B4E2J0 Q5W9G7 Q769F3 Q769F4 Q96AB1 Q9P208
Symbols TAPL
EST122234

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

 IMPC Term (1)

Gene RIF (11)

PMID Text
24013930 The structure of the unique domain of TAPL, is reported.
22641697 LAMP proteins retain TAPL on the limiting membrane of endosomes and prevent its sorting to intraluminal vesicles.
21212514 These results suggest that TAPL may be localized to the microdomains (lipid rafts) of lysosomal membranes enriched in cholesterol.
20377823 By dissecting ABCB9, distinct functions were assigned to the core complex and the extra N-terminal transmembrane domain.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18952056 These results suggest that the sorting signal for lysosomes is present within the amino-terminal transmembrane domain (Met(1)-Arg(141)) of the TAPL molecule.
18434309 analysis of lipid activation of the lysosomal transport complex ABCB9
18175933 The ATP-binding of TAPL required Mg(2+), and was observed at neutral pH. Chemical cross-linking experiments suggested that TAPL forms a homodimer in the membrane and under the solubilized conditions.
17977821 the TAPL-specific translocation of peptides into isolated lysosomes strictly requires ATP hydrolysis
16554024 These findings suggest that the transport activity of hTAPL is important for conferring high valinomycin-sensitive phenotype to yeast.
More...

AA Sequence

MRLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAK      1 - 70
NSALGPRRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWLLSTV     71 - 140
RPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSYTKPDVAFLVAASFFLIVAALGETFLPYYTG    141 - 210
RAIDGIVIQKSMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDEN    211 - 280
RTGDLISRLTSDTTMVSDLVSQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYY    281 - 350
KRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTL    351 - 420
LVVQVSILYYGGHLVISGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMV    421 - 490
HDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEG    491 - 560
GRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQD    561 - 630
GYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHR    631 - 700
LSTVEHAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA        701 - 766
//

Text Mined References (34)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24013930 2013 Conformational stabilization of the membrane embedded targeting domain of the lysosomal peptide transporter TAPL for solution NMR.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22641697 2012 The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21212514 2011 Transporter associated with antigen processing-like (ABCB9) stably expressed in Chinese hamster ovary-K1 cells is sorted to the microdomains of lysosomal membranes.
21194361 2011 The lysosomal polypeptide transporter TAPL: more than a housekeeping factor?
20377823 2010 Tuning the cellular trafficking of the lysosomal peptide transporter TAPL by its N-terminal domain.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...