Property Summary

NCBI Gene PubMed Count 12
PubMed Score 34.45
PubTator Score 15.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.900 5.2e-06
medulloblastoma, large-cell 1.300 4.8e-04
osteosarcoma -1.936 3.6e-09
ovarian cancer 1.300 2.0e-02

 GO Function (1)

Gene RIF (8)

AA Sequence

MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR      1 - 70
KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD     71 - 140
IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY                    141 - 194
//

Text Mined References (15)

PMID Year Title