Property Summary

NCBI Gene PubMed Count 12
PubMed Score 32.03
PubTator Score 15.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.59115075263493E-9
group 3 medulloblastoma 2254 5.23321435226234E-6
medulloblastoma, large-cell 6234 4.76541060340147E-4
ovarian cancer 8492 0.020200866154121

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.936 0.000
group 3 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.300 0.000
ovarian cancer 1.300 0.020

Synonym

Accession Q9NP77 Q9BZS6 Q9H933 CTD phosphatase SSU72
Symbols HSPC182
PNAS-120

Gene

PDB

3O2Q   3O2S   4H3H   4H3K  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25319827 HIV-1 Tat recruits Ssu72 together with P-TEFb to the integrated HIV-1 proviral promoter in TNF-alpha treated 2D10 T cells
24149858 Aurora B kinase directly targets Ssu72 phosphatase for regulation of sister chromatid cohesion during early mitosis.
23070812 The pSer7 phosphatase activity of Ssu72 is approximately 4000-fold lower than its pSer5 phosphatase activity toward a peptide substrate
20861839 crystal structure at 2.4 A resolution of the amino-terminal domain (residues 30-340) of human symplekin in a ternary complex with the Pol II carboxy-terminal domain (CTD) Ser 5 phosphatase Ssu72 and a CTD Ser 5 phosphopeptide
20818333 Data suggest that Ssu72 is a novel cohesin-binding protein capable of regulating cohesion between sister chromatid arms.
18976975 Knockdown of SSU72 RNA polymerase II CTD phosphatase homolog by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18597038 Observational study of gene-disease association. (HuGE Navigator)
15659578 Molecular cloning and characterization of functions of human ssu72.

AA Sequence

MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR      1 - 70
KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD     71 - 140
IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY                    141 - 194
//

Text Mined References (15)

PMID Year Title
24149858 2013 Functional interplay between Aurora B kinase and Ssu72 phosphatase regulates sister chromatid cohesion.
23070812 2012 An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
22235117 2012 Ssu72 phosphatase-dependent erasure of phospho-Ser7 marks on the RNA polymerase II C-terminal domain is essential for viability and transcription termination.
21269460 2011 Initial characterization of the human central proteome.
20861839 2010 Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
20818333 2010 The hsSsu72 phosphatase is a cohesin-binding protein that regulates the resolution of sister chromatid arm cohesion.
18597038 2009 High resolution linkage and linkage disequilibrium analyses of chromosome 1p36 SNPs identify new positional candidate genes for low bone mineral density.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15659578 2005 Conserved and specific functions of mammalian ssu72.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...