Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.46
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.87624871943947E-23
breast carcinoma 1614 1.04481670422217E-20
lung adenocarcinoma 2714 4.59257003536458E-18
lung carcinoma 2844 1.57937708573766E-14
posterior fossa group A ependymoma 1511 8.59778551844608E-12
intraductal papillary-mucinous adenoma (IPMA) 2956 3.09369598525415E-5
lung cancer 4473 4.88524209343457E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.1191181847294E-5
acute quadriplegic myopathy 1157 6.18882794212243E-5
ductal carcinoma in situ 1745 1.41123707512168E-4
pilocytic astrocytoma 3086 4.5735415905359E-4
interstitial cystitis 2299 4.88744049005282E-4
invasive ductal carcinoma 2950 6.49557175183022E-4
ovarian cancer 8492 6.84084612880042E-4
nasopharyngeal carcinoma 1056 7.75902238528506E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00131322130344609
ulcerative colitis 2087 0.00307773534889438
group 3 medulloblastoma 2254 0.0052932994610694
Atopic dermatitis 944 0.00562852726707926
fibroadenoma 557 0.0136640764735684
aldosterone-producing adenoma 664 0.0182853018344533
medulloblastoma, large-cell 6234 0.0207339499341667
Breast cancer 3099 0.0287488147178593
esophageal adenocarcinoma 737 0.0294922197126826
adrenocortical carcinoma 1427 0.0399361960983352
Disease Target Count Z-score Confidence
Vesicoureteral reflux 28 3.745 1.9

Expression

Synonym

Accession Q9NP74 Q9H7E6 Q9NPM5 Q9NPM6 Q9NPS0
Symbols PALML
C1orf11

Gene

  Ortholog (10)

Gene RIF (3)

PMID Text
24810057 findings define palmdelphin as a target of serine-46-phosphorylated p53 that controls cell death in response to DNA damage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEAELVKGRLQAITDKRKIQEEISQKRLKIEEDKLKHQHLKKKALREKWLLDGISSGKEQEEMKKQNQQ      1 - 70
DQHQIQVLEQSILRLEKEIQDLEKAELQISTKEEAILKKLKSIERTTEDIIRSVKVEREERAEESIEDIY     71 - 140
ANIPDLPKSYIPSRLRKEINEEKEDDEQNRKALYAMEIKVEKDLKTGESTVLSSIPLPSDDFKGTGIKVY    141 - 210
DDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPG    211 - 280
PNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTPQKRLMTP    281 - 350
WEESNVMQDKDAPSPKPRLSPRETIFGKSEHQNSSPTCQEDEEDVRYNIVHSLPPDINDTEPVTMIFMGY    351 - 420
QQAEDSEEDKKFLTGYDGIIHAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP    421 - 490
HENTNHKSPHKNSISLKEQEESLGSPVHHSPFDAQTTGDGTEDPSLTALRMRMAKLGKKVI             491 - 551
//

Text Mined References (16)

PMID Year Title
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24810057 2014 Palmdelphin, a novel target of p53 with Ser46 phosphorylation, controls cell death in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...