Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.82
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy 1.024 6.2e-05
adrenocortical carcinoma -1.185 4.0e-02
aldosterone-producing adenoma -1.106 1.8e-02
Atopic dermatitis -1.200 5.6e-03
Breast cancer -2.500 2.9e-02
breast carcinoma -1.700 5.9e-04
ductal carcinoma in situ -2.500 1.4e-04
ependymoma 1.800 2.6e-02
esophageal adenocarcinoma -1.400 2.9e-02
fibroadenoma -1.800 1.4e-02
group 3 medulloblastoma 1.500 5.3e-03
interstitial cystitis 1.200 4.9e-04
intraductal papillary-mucinous adenoma (... -2.800 3.1e-05
intraductal papillary-mucinous carcinoma... -2.500 1.3e-03
intraductal papillary-mucinous neoplasm ... -3.400 6.1e-05
invasive ductal carcinoma -3.300 6.5e-04
lung adenocarcinoma -1.700 8.3e-15
lung cancer -3.000 4.9e-05
lung carcinoma -2.200 1.6e-14
medulloblastoma, large-cell 2.300 2.7e-02
nasopharyngeal carcinoma -1.200 7.8e-04
non-small cell lung cancer -2.438 1.9e-23
ovarian cancer -1.900 6.8e-04
Pilocytic astrocytoma 1.100 4.6e-04
ulcerative colitis 1.100 3.1e-03

Gene RIF (3)

AA Sequence

MEEAELVKGRLQAITDKRKIQEEISQKRLKIEEDKLKHQHLKKKALREKWLLDGISSGKEQEEMKKQNQQ      1 - 70
DQHQIQVLEQSILRLEKEIQDLEKAELQISTKEEAILKKLKSIERTTEDIIRSVKVEREERAEESIEDIY     71 - 140
ANIPDLPKSYIPSRLRKEINEEKEDDEQNRKALYAMEIKVEKDLKTGESTVLSSIPLPSDDFKGTGIKVY    141 - 210
DDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPG    211 - 280
PNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTPQKRLMTP    281 - 350
WEESNVMQDKDAPSPKPRLSPRETIFGKSEHQNSSPTCQEDEEDVRYNIVHSLPPDINDTEPVTMIFMGY    351 - 420
QQAEDSEEDKKFLTGYDGIIHAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP    421 - 490
HENTNHKSPHKNSISLKEQEESLGSPVHHSPFDAQTTGDGTEDPSLTALRMRMAKLGKKVI             491 - 551
//

Text Mined References (17)

PMID Year Title