Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.80
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -1.400 8.9e-10
ependymoma 1.100 9.3e-03
glioblastoma 1.100 2.7e-02
intraductal papillary-mucinous adenoma (... 1.600 1.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.500 9.3e-03
invasive ductal carcinoma 1.100 1.8e-03
osteosarcoma -1.486 3.7e-03
ovarian cancer -2.600 3.4e-08
pancreatic ductal adenocarcinoma liver m... -1.670 1.1e-02
Pick disease -2.000 1.5e-05
progressive supranuclear palsy -1.500 3.0e-02
psoriasis -1.500 1.4e-06
spina bifida -1.281 4.2e-02
tuberculosis and treatment for 6 months -1.200 1.9e-02

Gene RIF (7)

AA Sequence

MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKED      1 - 70
IQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCRVLTCPGQAKSIA     71 - 140
SAPGKCQDSAALTSTAFSGLDFGLLSGYLHKQALVTATHPTCTLLFPSCHAFFPLPLTPTLYKMHKGWKN    141 - 210
YCSQKSLNEASMDEYLGSLGLFRKLTAKDASCLFRAISEQLFCSQVHHLEIRKACVSYMRENQQTFESYV    211 - 280
EGSFEKYLERLGDPKESAGQLEIRALSLIYNRDFILYRFPGKPPTYVTDNGYEDKILLCYSSSGHYDSVY    281 - 350
SKQFQSSAAVCQAVLYEILYKDVFVVDEEELKTAIKLFRSGSKKNRNNAVTGSEDAHTDYKSSNQNRMEE    351 - 420
WGACYNAENIPEGYNKGTEETKSPENPSKMPFPYKVLKALDPEIYRNVEFDVWLDSRKELQKSDYMEYAG    421 - 490
RQYYLGDKCQVCLESEGRYYNAHIQEVGNENNSVTVFIEELAEKHVVPLANLKPVTQVMSVPAWNAMPSR    491 - 560
KGRGYQKMPGGYVPEIVISEMDIKQQKKMFKKIRGKEVYMTMAYGKGDPLLPPRLQHSMHYGHDPPMHYS    561 - 630
QTAGNVMSNEHFHPQHPSPRQGRGYGMPRNSSRFINRHNMPGPKVDFYPGPGKRCCQSYDNFSYRSRSFR    631 - 700
RSHRQMSCVNKESQYGFTPGNGQMPRGLEETITFYEVEEGDETAYPTLPNHGGPSTMVPATSGYCVGRRG    701 - 770
HSSGKQTLNLEEGNGQSENGRYHEEYLYRAEPDYETSGVYSTTASTANLSLQDRKSCSMSPQDTVTSYNY    771 - 840
PQKMMGNIAAVAASCANNVPAPVLSNGAAANQAISTTSVSSQNAIQPLFVSPPTHGRPVIASPSYPCHSA    841 - 910
IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQDTK    911 - 980
VLQYYFNLGLQCYYHSYWHSMVYVPQMQQQLHVENYPVYTEPPLVDQTVPQCYSEVRREDGIQAEASAND    981 - 1050
TFPNADSSSVPHGAVYYPVMSDPYGQPPLPGFDSCLPVVPDYSCVPPWHPVGTAYGGSSQIHGAINPGPI   1051 - 1120
GCIAPSPPASHYVPQGM                                                        1121 - 1137
//

Text Mined References (25)

PMID Year Title